(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE458

PENCW_10.PE458       Location/Qualifiers
FT   CDS_pept        join(1102430..1102466,1102520..1103505)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950918"
FT                   /orf_name="Pc13g04580"
FT                   /product="Pc13g04580 protein"
FT                   /protein_id="CAP91527.1"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="UniParc:UPI0001830C4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B2"
FT                   /transl_table=1
FT                   /translation="MASYGLLGQPEEDALHKSRLLNVEEKPFKRISKRLLNPESLIVSQ
FT                   SSLPLTPPPEETDADSDATATEAEKQKRLEEWRHFREDVSLDFAAFEASIARVQFLLTS
FT                   NEQERQRYATERVQILSTMQSVRESTADLRSQLEEAQRLLSLRKTYDELTDKITSNRLL
FT                   KPREDQSANLQKLRLEIADLEKESKDYAMTWAERREQFGRIVDEGMQLRRLIRDEKEEV
FT                   ERREGMQEGEDGDEGDVASKGKASSGNTPPGHESDAVTPSQHGQDEAGRPSALHVEKSG
FT                   AAGAASPLRQVTTAQSDGAHEDTNMLDEGEIPAVSDGELSDLEEGEELPDDFGGKMDTT
FT                   "
     atggcttcgt acgggctgct aggccagcca gaagaagatg cgctccacaa gtcgcgcctc        60
     ctcaacgtcg aagaaaaacc attcaagcga atttcaaaac gactattgaa ccccgaatct       120
     ctcattgtct cacaatcatc gctccctctc acccctcccc ccgaagagac cgacgccgat       180
     tccgatgcga ccgcaacaga agctgagaaa cagaaaaggc tcgaagaatg gcgccacttc       240
     cgcgaggatg tctcactcga ctttgccgcc tttgaggcca gcattgcgcg cgtgcagttc       300
     cttcttacca gcaacgagca agaacgccag cgatatgcca ccgagcgagt tcagattcta       360
     tcgacaatgc agtcagtacg agaaagcacg gccgatctac gcagtcaact tgaagaggca       420
     caacgacttc tctccttgcg aaagacctac gatgaattga cggacaaaat cacgagcaac       480
     cgcctactca agccgcgcga agaccagtcc gcgaaccttc agaaattgcg actagagatc       540
     gcagatctcg agaaggaaag taaggattac gccatgacct gggctgagcg gcgcgagcag       600
     ttcggtcgta ttgtggacga ggggatgcag cttcgtcgcc tgatccgcga tgagaaagag       660
     gaagtcgagc gccgcgaagg catgcaggag ggcgaagacg gcgacgaggg agatgtcgca       720
     tccaagggca aggctagcag tgggaatacc cctcctggtc acgaaagcga tgccgtgacc       780
     ccctcccagc acggccaaga tgaggccggt cggccatctg ctctccatgt tgagaagtcc       840
     ggggctgccg gtgctgcgtc acctttgcga caagtcacaa ctgcccagag cgatggggca       900
     catgaggaca ccaatatgct ggatgagggt gaaatccctg ctgttagtga tggcgaatta       960
     tctgacctcg aggaagggga ggaactccct gatgacttcg gcggaaagat ggatactacc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page