(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE459

PENCW_10.PE459       Location/Qualifiers
FT   CDS_pept        join(complement(1103993..1104160),
FT                   complement(1103824..1103910),complement(1103656..1103757))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950919"
FT                   /orf_name="Pc13g04590"
FT                   /product="Pc13g04590 protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="tubulin complex assembly"
FT                   /cellular_component="microtubule"
FT                   /protein_id="CAP91528.1"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007021"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="UniParc:UPI0001830C4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B3"
FT                   /transl_table=1
FT                   /translation="MAPRTQLEITTSSVIRLVKEEASYHNELQQQAERIKKLEADTTDG
FT                   DENREYTLKQEHMSLEETKKVLPTLKEKIVQTVANLEALIIEEGKKGSESNVEHITAAK
FT                   EAIAQAKTAQREIS"
     atggcacccc gcacgcagct agagatcacc acatcctccg tgatccgcct tgtcaaggag        60
     gaagcttcgt atcacaacga gcttcagcag caggctgaac gtatcaagaa gctggaggct       120
     gataccactg acggtgacga gaaccgcgag tataccctga agcaagagca catgtctctt       180
     gaggagacca agaaggtcct gcctacgttg aaggagaaga ttgtgcagac tgttgcgaac       240
     ctggaagctc tgattatcga ggagggcaag aagggatcgg agagcaacgt tgagcacatt       300
     accgctgcca aagaagccat tgctcaagct aagactgcac agcgcgagat ctcgtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page