(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE46

PENCW_10.PE46        Location/Qualifiers
FT   CDS_pept        join(110609..110643,110855..110961,111059..111771)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948699"
FT                   /orf_name="Pc13g00460"
FT                   /product="Pc13g00460 protein"
FT                   /protein_id="CAP91115.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001830E94"
FT                   /db_xref="UniProtKB/TrEMBL:B6H174"
FT                   /transl_table=1
FT                   /translation="MHKYRRISILASYITFIPIYCRHLGTDKHHLSSTLSPFPLNSVAQ
FT                   NHASTLEGGDISALARTHSTFYPKLRLALIKYNIRHQNSSALHWAAKNNNRAFAKTLLS
FT                   YQADVNALHDGFSPLMTAAKYGSELITNLLLRKKNLHVNRRNADGESALWYSVAKESSA
FT                   VVNQLLQHPRTKIDLPNREGQTVLWLAVFRGNRDLVSLLLSRGANPNTMDRYGMSPWIQ
FT                   SCVRRGESIKYLLLDHMKAVSPEIFSVDGVFAENGKSICEDSSSYGQSQVQLRAKRVRY
FT                   AHV"
     atgcacaaat atcgtagaat atcaatccta gcatcttaca tcactttcat tcctatctat        60
     tgccgtcacc ttggaaccga taaacatcat ctgagcagca cgttgtctcc ctttccactg       120
     aactccgtcg cccaaaatca tgcaagcacc ctagagggag gcgatatttc tgctcttgct       180
     cggacacact caaccttcta tcccaagcta cgcctagccc tgatcaaata taatatcagg       240
     caccaaaaca gttctgcgct tcactgggcc gctaaaaaca acaatcgcgc ctttgcaaag       300
     accttgcttt cttaccaggc cgacgtgaat gcgctgcacg atggtttctc tcctctcatg       360
     acggccgcga aatatggctc ggagctaatt accaatctct tgctgcgtaa gaaaaatttg       420
     cacgtgaata ggagaaacgc agatggcgag agtgctctct ggtatagtgt ggcgaaagag       480
     tcatctgcag ttgtgaacca gctccttcaa caccctcgta ccaagatcga tcttccaaac       540
     cgcgagggcc aaacagtgct ctggcttgcc gtctttagag gtaacagaga cttggtgagc       600
     ctgctactct caagaggcgc caatcccaat accatggacc gatacggaat gtcgccatgg       660
     atccagtcat gcgtcaggcg cggtgaatcc atcaaatatc tgctcctaga tcacatgaaa       720
     gctgtttctc ctgagatatt ttcggtggat ggtgtatttg ctgaaaatgg aaaatcgata       780
     tgcgaggaca gctcttccta cggacaaagc caagttcagc tacgagcaaa gcgggtaaga       840
     tatgcccatg tctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page