(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE460

PENCW_10.PE460       Location/Qualifiers
FT   CDS_pept        join(1105292..1105349,1105414..1105490,1105571..1106530)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825171"
FT                   /orf_name="Pc13g04600"
FT                   /product="Pc13g04600 protein"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91529.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniParc:UPI0001830C4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B4"
FT                   /transl_table=1
FT                   /translation="MPAPSLLHLATATAIRFVKDLDDLGAMPYSLARPILLNIQNPEKL
FT                   HAMELASPHLAEEDEELWLELIKRDIPDWEKYHLPDNTNNWYGVYCDLRDQAQRSLDAD
FT                   AERMKMAIDGISAKRALLTPKLIPERKGLRMAGSRPSFRQRHATYNHRTGGGGVEKKPS
FT                   IFQPQKRNTALTMPTKSLNNRASQVKRAPIGLVEEHRRPAEQAAPKPPSKAQPLPPRIS
FT                   RRPGMSPPSLQHPMLAKNEARLRALTSTASAAASPRGASSNDASGVKKSPAVATEPKPT
FT                   LKRRATSPPHGAENPSASSSSRPAPCAPSSSSSSSSSSLPIPHTSSLPPSGPPSSGPPT
FT                   PRPGVIRRRPAPSIFMPAKRRQLS"
     atgccggccc catcactact tcacctagcc acagccacgg ctatccgctt tgtcaaagac        60
     ctggatgatc taggcgccat gccatactca cttgcccgtc ctatcttgct taatatccaa       120
     aaccccgaaa agctgcacgc catggagctt gcatcccctc acctcgccga agaagacgaa       180
     gaactgtggc ttgagctcat taaacgggac attcccgact gggagaagta ccacctcccg       240
     gataatacca acaactggta tggggtttac tgtgatctcc gggatcaagc ccaacgttca       300
     cttgatgcgg atgcggagag gatgaaaatg gcaattgacg gcattagcgc caagcgtgca       360
     ctcctcactc ccaaactcat ccctgagcgc aagggcttgc gcatggctgg atcccggccc       420
     tctttccgac aacgccatgc tacatataac cacaggacgg gcggcggcgg tgttgaaaag       480
     aagcctagca tattccagcc acagaagcgt aacaccgcgc tgacaatgcc taccaaatct       540
     ctaaacaacc gtgcgtcgca agtcaagcgt gcaccgattg gcttggttga agaacaccgt       600
     cgccccgccg agcaggcagc accaaagccg ccatcaaagg cccaaccact tcctccgcgc       660
     atcagccggc gcccaggcat gtctccaccc tctctccagc accccatgct tgccaagaat       720
     gaggcacgac tacgcgcact gacttccacc gcctctgcgg ccgcctcacc ccgtggcgca       780
     tccagtaacg atgcgtctgg cgtaaaaaag tcaccagctg tggccactga gcccaagcct       840
     acgctgaagc gccgtgcgac ctctccccct catggtgcag agaacccatc tgcttcttct       900
     tcctctcgcc ctgccccttg cgccccttct tcttcttctt cttcttcttc ttcttctctc       960
     ccgatccctc acacatcatc tctgccccca tccggcccgc cttcctccgg gcctcctacg      1020
     ccccgcccgg gcgtcattcg tcgacgtccg gcgccgagca ttttcatgcc ggcaaagcgg      1080
     cgtcagttat cgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page