(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE461

PENCW_10.PE461       Location/Qualifiers
FT   CDS_pept        join(complement(1107893..1107904),
FT                   complement(1107730..1107783),complement(1107514..1107596),
FT                   complement(1107313..1107412))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978335"
FT                   /orf_name="Pc13g04610"
FT                   /product="Pc13g04610 protein"
FT                   /protein_id="CAP91530.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI0001830C4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B5"
FT                   /transl_table=1
FT                   /translation="MLIKVRTLTGKEIELDIEPDYKVSRIKERVEEKEGIPPVQQRLIF
FT                   GGKQMADDKTASEYNLEGGATLHLVLALRGGCAAKSM"
     atgttgatca aggtccgaac actcaccggc aaggagatcg agctcgacat cgagcctgac        60
     tacaaggtct cccggataaa ggagcgtgtc gaggagaagg agggaatccc cccagtccag       120
     caacgactca ttttcggcgg caagcagatg gcggatgaca agacagcctc agaatataac       180
     ctcgaaggtg gcgccacact ccatctcgtg cttgctctgc gtggaggatg cgctgcgaag       240
     tcgatgtaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page