(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE462

PENCW_10.PE462       Location/Qualifiers
FT   CDS_pept        join(1108498..1108572,1108624..1108873,1108940..1109556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129535"
FT                   /orf_name="Pc13g04620"
FT                   /product="Pc13g04620 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="RNA metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91531.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniParc:UPI0001830C50"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B6"
FT                   /transl_table=1
FT                   /translation="MTNEPQHVTADNQFQQLITHSENDPKKLQIAYENHRSNRNALFRD
FT                   QICQPGFCEWKEDEILSKVLEAEKGLTDFVDPRNNLAFWARPPKHIRNLVYKIQQEIGP
FT                   LIGPGLWLVPPHHLHMTTLEIRSALTGPEIDEIAASLQMSGLVAELASYTLTHRARLVK
FT                   PIISYDTSAIALSFVPAAGEEDRNVYSGKDDQFTYHHLRSDLYNIVTQSGCPIAARYTV
FT                   PSAHITIARFIAPSDPKKGESDSPKEFEKEASRLIEKIEDLNHELRSNVWKRLGNPCQG
FT                   QWVIGHEKGLELMKGRTWYGVGDSIVLGEGFV"
     atgaccaatg aaccgcaaca tgtaacagct gacaaccagt tccagcaatt gatcactcat        60
     tctgaaaatg acccgaaaaa attgcaaatt gcctatgaga accatagaag caatagaaat       120
     gcccttttca gagaccaaat ctgccaacct ggattctgcg aatggaaaga ggatgagatc       180
     ctgtccaaag tcctcgaggc agagaagggg ttgacagatt tcgtcgaccc gagaaacaac       240
     cttgcctttt gggcacgccc cccaaagcat atccggaact tggtctacaa gatccagcaa       300
     gagattggtc ctttaatagg tcctggtctc tggctcgtac ccccgcacca tctgcacatg       360
     accacgctcg agatcaggtc tgcactaaca gggcctgaaa ttgatgagat agccgcttcc       420
     ctccagatga gcgggctcgt agcagagctg gcaagctaca ctctcaccca ccgtgcccgg       480
     ctggtgaagc caataatcag ctacgacact tcggctattg ctctgagctt tgttcccgca       540
     gctggcgagg aagatcgcaa tgtgtatagt gggaaagatg atcagttcac gtatcaccat       600
     ctgcgaagtg atctctacaa tatcgtgact caatctggct gtccaatcgc ggctaggtat       660
     accgttcctt ctgcgcatat caccattgcg cggtttattg cgcccagtga ccccaaaaaa       720
     ggagagtcag attccccaaa ggaatttgag aaggaagcat cgcgacttat tgaaaagatc       780
     gaagatctca atcatgaact ccgctcaaat gtgtggaaga gattggggaa cccatgtcaa       840
     gggcaatggg tgataggtca tgaaaagggg ttggaattga tgaagggccg gacatggtat       900
     ggagtagggg acagtattgt acttggagaa ggattcgtat ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page