(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE463

PENCW_10.PE463       Location/Qualifiers
FT   CDS_pept        join(1110054..1110056,1110284..1110376,1110445..1110629,
FT                   1110691..1110730)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672475"
FT                   /orf_name="Pc13g04630"
FT                   /product="Pc13g04630 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91532.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI0001830C51"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B7"
FT                   /transl_table=1
FT                   /translation="MVNIPKTRRTYCKSKDCHKHQQHKVTQYKAGKASLFAQGKRRYDR
FT                   KQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKAKKQLALKRCKHFELGGDKKTKGAAL
FT                   VF"
     atggtcaaca ttcccaaaac ccgccggacg tactgcaagt ccaaggactg ccacaagcac        60
     caacagcaca aggtcaccca gtacaaggct ggcaaggcct ccctcttcgc ccagggtaag       120
     cgccgttacg accggaagca gagtggttac ggtggtcaga ccaagcccgt cttccacaag       180
     aaggccaaga ccaccaagaa ggtcgtcctg cgtctcgagt gcactgcttg caaggccaag       240
     aagcagctcg ccctgaagcg ctgcaagcac ttcgagctgg gtggtgacaa gaagaccaag       300
     ggtgctgctc ttgttttcta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page