(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE465

PENCW_10.PE465       Location/Qualifiers
FT   CDS_pept        join(complement(1115980..1116360),
FT                   complement(1115823..1115891))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672477"
FT                   /orf_name="Pc13g04650"
FT                   /product="Putative uncharacterized protein Pc13g04650 "
FT                   /protein_id="CAP91534.1"
FT                   /db_xref="UniParc:UPI0001830C53"
FT                   /db_xref="UniProtKB/TrEMBL:B6H236"
FT                   /transl_table=1
FT                   /translation="MEDEGLGYAEVKSGTITSSSEGLWREGENIFNGQELVLGNIQLPV
FT                   WKGSKRGTPRYMLWVWIAGLPVMGPYENRNENPHWLSGDINVFGVEMKSGLSKSSILQP
FT                   DSICNRRQPFFLKPHEVASIGVNPGGDNIPNTGRPMHETLLEGTG"
     atggaggatg aaggtctagg ctacgcggag gtgaaaagcg gcacaatcac ctcctcgtct        60
     gaggggttgt ggagagaggg cgagaatatt ttcaatggac aggaactggt tctcgggaat       120
     atccaactgc cggtttggaa gggttcaaaa aggggtactc cgcgatatat gttgtgggta       180
     tggatcgctg gattgcctgt catgggtcca tatgaaaata gaaatgagaa tccacactgg       240
     ttgagtgggg atattaacgt ttttggagtt gagatgaaaa gcggattgtc gaagtcttct       300
     atactccaac ccgactcaat ttgtaatagg aggcaaccct ttttcttgaa gccacatgaa       360
     gttgcgtcaa tcggagtgaa ccctggaggt gacaacattc cgaatacggg gagaccgatg       420
     catgaaactc ttctagaagg gacaggttga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page