(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE466

PENCW_10.PE466       Location/Qualifiers
FT   CDS_pept        join(1116363..1116989,1117040..1118226,1118265..1118691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950920"
FT                   /orf_name="Pc13g04660"
FT                   /product="Pc13g04660 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91535.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C54"
FT                   /db_xref="UniProtKB/TrEMBL:B6H237"
FT                   /transl_table=1
FT                   /translation="MASSRSTGKRLPISCQACRTRKIRCSRDGRPCQTCVRRGLGAEDC
FT                   IYLGQPRLSTEQSSPGDSVVQSELLARIRNLEALLQKQMASNAGTPNGGAVSPLGGTSA
FT                   AGSFSEPETWDSLGPMLDNVGKLHTSPSGHVRYVPLTSQWESLVAKSCAVECLPNLDSD
FT                   IAEDDDDLQIPLARNGSISRAELLSVLPPGRYCDTLKDVYLQVFSSVFHILHDLTFEAE
FT                   YQHFCHDPGSVSTSWLALLFAILAIAVSALDDDHPLLSDLGRERTVSRNIKVLSARYRS
FT                   AALRCLAADGVMSRHSINSLQALILINYARVHRGLPIWTLLGFTHHVAISMGCHLDPER
FT                   FTLGPIEREERRRVWAGLMVLYTIQNTAFGSLDQQALPQDVKMPADIDDVDLLTSPSSK
FT                   RPAPSTFPRPTQMTYLLLNFRLYRTSSKICETIFSYPSTSRFTTSHLEAEIISVREMVE
FT                   ARYAADRNNPLLIHHQANHHILYSQIHQLLLLLLRPGLCRYLQGEITPETCATRAKCIA
FT                   SAKASLSIFETLLETQSFKPYKWYTSGLGSFHAFHAAVTLAVILLIPESQSEYEEIKDI
FT                   LDRALDMFASLSVRSVFCSKAVPIIRQMILVTNAQTSDVASTKYNPQSPTHSQSHLQAQ
FT                   AQAQAQAQVQAQVQHQQNQANIQSQSHNHLVPSIQIPPSMSNLSPGMTMQDNYALSHPH
FT                   SQSGSPVPTVASTSSEHTMHSSFGQMHPQNWISPTSVPWETLGAGTGGYGFD"
     atggcctcat cccgttcaac aggcaagcgg ctccccatca gctgtcaggc ctgccgaaca        60
     cgaaagatcc gatgttcgcg cgacggccgt ccatgccaaa cttgcgttcg gcgcggtcta       120
     ggcgccgaag actgcatcta tctcggccag ccgcggcttt caactgagca gtcctcgccc       180
     ggcgacagcg tagtgcagag tgaattgcta gcgcgaattc ggaacctgga agccttgctc       240
     cagaagcaga tggcctcgaa cgctggcacg ccaaacggtg gcgcggtctc gccactgggt       300
     gggacgagtg cagctggcag tttctctgaa cctgagacat gggactcact cggccccatg       360
     ttggataatg ttggcaaact tcatacttca ccttctggcc atgtgcgcta tgtgccacta       420
     acttcgcagt gggagtcttt agtggcaaag agctgcgccg tggagtgttt gccgaattta       480
     gattcggata tcgccgagga tgatgatgat ttgcaaatcc cgctggcgag gaatgggagt       540
     atctcgcgtg ctgagttgct gtcggttctg ccgcctggcc ggtattgcga tactctcaag       600
     gatgtttatc ttcaggtctt ctcctcggtt ttccatattc ttcacgacct gacatttgaa       660
     gccgagtacc aacacttttg ccatgatccc ggtagtgtgt ctacgtcatg gctggctttg       720
     ctattcgcca ttcttgcgat cgctgtaagc gcactcgatg atgaccatcc tctgctgtct       780
     gatctgggac gagaacgaac ggtcagccga aatatcaaag tgctgtcagc acgatatcga       840
     tctgccgcgt tgaggtgtct cgccgccgat ggagtgatgt cccggcattc gatcaactca       900
     ttgcaagctt taattcttat aaattacgcc cgagtccatc gcggcctacc aatctggaca       960
     ttgctaggat tcactcatca tgttgcgata tcaatgggct gccatttaga cccagagcgg      1020
     tttactcttg gaccaattga gcgagaagag cgacgacggg tctgggctgg attgatggtg      1080
     ctgtacacca tccaaaacac agcattcggg agcctggatc agcaggctct accgcaagac      1140
     gtgaaaatgc ccgcagacat cgacgacgtt gacctgctca ccagcccaag ttcgaaaaga      1200
     ccagcaccct caacattccc ccgcccaacg cagatgacct acctcctctt gaatttccga      1260
     ctatacagaa cctcctcgaa gatttgcgaa acgatcttca gctacccaag tacatcccgc      1320
     ttcaccacgt ctcacctcga agcggaaata atatccgtcc gtgaaatggt cgaggctcgc      1380
     tatgccgccg atagaaacaa ccccctactc attcaccacc aagccaatca ccacatcctc      1440
     tacagccaga tccaccaact tctccttcta ctcctccgcc caggtctctg tcggtaccta      1500
     caaggcgaga ttacacctga aacttgcgct acaagggcaa agtgcatcgc ttccgccaag      1560
     gcttcgcttt ccatcttcga aactctcctc gaaacacagt ccttcaagcc ctacaaatgg      1620
     tataccagcg gactaggcag ttttcacgcc ttccacgctg cagtcacatt ggctgtcatc      1680
     ctgctcattc ccgagtccca gtccgagtac gaagagatca aagatattct cgatcgggca      1740
     ctagatatgt tcgcctcact ctcagtccgc agtgttttct gcagcaaggc tgttcccata      1800
     attcgacaga tgatactagt gactaacgca caaaccagcg acgttgcctc gacgaaatac      1860
     aacccccagt cacccaccca ctctcagtcc cacctccaag cccaggccca ggctcaagcc      1920
     caggctcaag tccaagctca agtccagcac cagcaaaacc aagccaatat ccaatctcag      1980
     tctcacaatc acctcgtacc aagcatccaa atcccaccct caatgtcaaa tctctccccc      2040
     gggatgacaa tgcaggacaa ctatgccctc tcgcacccac actcgcaatc cggatccccg      2100
     gtgccaactg ttgcatcgac ctccagtgag cacaccatgc attccagttt cgggcagatg      2160
     cacccgcaaa actggattag ccctacttcc gttccgtggg agacattggg ggctggcact      2220
     ggggggtatg ggtttgatta g                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page