(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE467

PENCW_10.PE467       Location/Qualifiers
FT   CDS_pept        complement(1118990..1119589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825172"
FT                   /orf_name="Pc13g04670"
FT                   /product="Pc13g04670 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP91536.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001830C55"
FT                   /db_xref="UniProtKB/TrEMBL:B6H238"
FT                   /transl_table=1
FT                   /translation="MSSPTELRDQPKTWTKGEYLVSTDVSLIPIETLNTWYAGEEFYWA
FT                   KPMPEPTLRETLQNSLCFGLYRNPSQVRSQNQPDKTPENEASSESTLEFVGFARCITDY
FT                   TTFLFLTDVFVLSSLQGLGLGTWLVTCVQEVIESMPYLRRSLLLTGDWKRSVPFYERVM
FT                   DMELMVCNPPVNGEDAVGFAVMQRKSWGAPGFGEKP"
     atgtcctctc caacagaact acgagaccaa cccaaaacct ggacaaaggg agaatactta        60
     gtctcaaccg acgtatccct aatccccatc gaaaccctca acacctggta cgccggcgaa       120
     gaattctact gggcaaagcc aatgccagag cccactttgc gcgaaacatt gcagaactcc       180
     ctctgctttg ggctgtatcg caatccaagt caagtccgaa gtcagaacca gccagacaag       240
     acaccagaga acgaggcatc ctcagagtcc acactcgaat tcgtcggttt cgcacgctgc       300
     ataacagact atacaacgtt cctcttcttg acagacgtct ttgtcctgtc ctcactccag       360
     ggtcttggtc tgggaacgtg gcttgtaacc tgcgtgcagg aagttattga gtcgatgcct       420
     tatttgcgga gatcgttgct gcttactggg gattggaagc ggtcggtgcc gttttatgag       480
     agggttatgg atatggagct tatggtatgt aaccctccgg ttaatgggga ggatgcggtt       540
     ggctttgctg ttatgcagcg gaagtcttgg ggggctcctg ggttcgggga aaagccctag       600
//

If you have problems or comments...

PBIL Back to PBIL home page