(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE468

PENCW_10.PE468       Location/Qualifiers
FT   CDS_pept        complement(1120093..1120983)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129536"
FT                   /orf_name="Pc13g04680"
FT                   /product="Pc13g04680 protein"
FT                   /protein_id="CAP91537.1"
FT                   /db_xref="UniParc:UPI0001830C56"
FT                   /db_xref="UniProtKB/TrEMBL:B6H239"
FT                   /transl_table=1
FT                   /translation="MTTAAFKYIDRASYDPNATEPFKKPWGKVDGPGRSYQLIDLERKV
FT                   ENLRGQESDFTTDNSGFALYNSPAKETAFTDDAEVRAGYYAEVEDLLRKKLPGVKKVAI
FT                   FDHTIRRRTPGSARSPVQLVHVDQTPKAAEARVRRHLPEDEVEELLKGRYQIINVWRPI
FT                   ENPASDFPLALIDWRSIAPSDFVKVDLLYPKEWQEHGEVAPDPESISSTQGYEVKGETY
FT                   AIAPNEKHRFFYAKDMTPEEVMFIKCFDSRSHTMTEGKTDIAHGSGHTAFIDPQTPAGS
FT                   PGRQSIEVRCLVFYE"
     atgacgactg cagcctttaa atacatcgac cgggcttcct acgaccccaa cgccacagag        60
     cctttcaaaa agccgtgggg caaagtcgac ggaccaggcc gttcctacca actcatagac       120
     ctggagcgca aagtcgagaa tctccgaggg caagagtcgg acttcacaac ggacaattcc       180
     ggcttcgcct tgtacaactc acccgcgaag gagaccgcat tcaccgacga cgccgaagtg       240
     cgagcggggt actacgcaga ggtagaagac ctactccgca agaaacttcc tggggtgaaa       300
     aaagtagcca tcttcgacca taccatccgg cggcggacgc cgggctcagc gcgcagccct       360
     gtacagctgg tgcacgtgga ccaaacgccc aaagctgctg aggcgcgggt gcgtcgccac       420
     ctgccagagg atgaagtaga ggagctgttg aagggtcgat accagattat caatgtctgg       480
     cgtccgattg agaatccggc ttctgatttc ccgttggcgc tgattgattg gaggagtatt       540
     gctccttctg attttgtcaa ggttgatctt ctttatccaa aggagtggca ggagcatgga       600
     gaggtagcgc cggatcctga gtcgatatct tctacacagg ggtatgaggt caagggggag       660
     acttatgcta tcgctcctaa tgagaaacat cgtttctttt acgctaagga tatgacgccg       720
     gaggaagtca tgttcatcaa gtgcttcgat tcgaggagtc acactatgac tgaggggaag       780
     acggatattg cccacggctc gggacatact gctttcattg acccgcagac tccggctgga       840
     tcgccgggga ggcagagcat tgaagttcgc tgcctggtct tttacgaata a                891
//

If you have problems or comments...

PBIL Back to PBIL home page