(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE47

PENCW_10.PE47        Location/Qualifiers
FT   CDS_pept        join(complement(112570..113088),complement(112413..112512),
FT                   complement(112155..112342),complement(112000..112104))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977822"
FT                   /orf_name="Pc13g00470"
FT                   /product="Pc13g00470 protein"
FT                   /protein_id="CAP91116.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830E95"
FT                   /db_xref="UniProtKB/TrEMBL:B6H185"
FT                   /transl_table=1
FT                   /translation="MDPIKRQPSRPEPEWRDGTPDWAALERTSRPSVPSSRPQPGPVII
FT                   PPTLSLPHPALQKGQIEQTIQPVFENPWLTYEAIVVISQGQSVFLARHRKDKATLVDIH
FT                   LLKQQFSSVKPLLDTISQTSHPSFLGLVGCYCWEEQVFLVREPVELSVSHILASRCTIT
FT                   EDEIAAIVRPVLGGIQYLRCHGRALAALSADTILLTELGGVRIAGVEHSCQINAAEMDA
FT                   ATMKLFALAEMVERLLMKNPSQYPWSAEIKNLPEELKRCDSPEKLLRSKLFEQLGDEGE
FT                   LKMLVNAANKTAYHNLESYKRI"
     atggatccca taaagcgcca gccctctcga cctgagcctg agtggcgtga tggaacgccc        60
     gattgggccg ctttggaaag aacatctcgt ccttcagtgc cgtcttccag gccccagccc       120
     ggtccagtga taatcccccc tacactttcc ctccctcatc ctgcgctaca gaaaggccag       180
     attgaacaga ctattcaacc ggtcttcgaa aatccgtggt tgacgtacga ggcgatcgtg       240
     gtgatctctc aaggacagtc agtctttctg gcccgacaca gaaaagacaa agcgacactc       300
     gtcgatatcc atcttttgaa gcagcaattc tcatccgtca agccattgct ggatacaatc       360
     agccaaacat cacaccccag ctttctaggt ctggtggggt gctattgttg ggaggagcag       420
     gtatttctgg tccgggagcc agtagagctc tcggtaagtc acatcctcgc atcaagatgc       480
     actatcactg aggatgaaat tgctgcaatt gttcggccgg ttctcggagg aattcaatat       540
     ctgcgctgtc acgggagagc actcgctgcc ttgagtgccg atactattct actcacggaa       600
     cttggtgggg tcaggatcgc gggagtggag catagttgcc aaatcaatgc agccgagatg       660
     gacgctgcca ctatgaagct gtttgcctta gctgagatgg tggagaggct actcatgaag       720
     aatccttcac aatatccgtg gagtgccgag ataaaaaatc tgcctgaaga gctaaaaaga       780
     tgcgattcac cggaaaagct actacgcagc aaattgttcg agcaattggg ggatgagggc       840
     gaactgaaga tgctggtgaa tgcggcaaac aagactgctt accacaatct agagtcatac       900
     aagcgcatat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page