(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE470

PENCW_10.PE470       Location/Qualifiers
FT   CDS_pept        join(1122695..1123255,1123320..1124129)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950922"
FT                   /orf_name="Pc13g04700"
FT                   /product="Pc13g04700 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="CAP91539.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI0001830D16"
FT                   /db_xref="UniProtKB/TrEMBL:B6H241"
FT                   /transl_table=1
FT                   /translation="MKFSALLGLLTFAAAVSADIKDQQSPLSSPSIANLKSKIKNVVIL
FT                   EMENRSVDNLLGGQTIKGLDNPINNGPFCNPYNLTDPSAGTVCSSAKDFDSVLDDPDHS
FT                   VTGNNIEFYGSFVPNNAHIAQGKLTPTQHGFVHEQLRSYGDDADKAYLAKQVINYYIED
FT                   EVPVMTTLVQNYLAFNHWHSDHPGPTNPNRAFVLSGTSAGHGYNDETFNPDIHGLTHRS
FT                   IFQQLSETNHTWKNYYTSPSMVDAYFFNWTFTSGNSDKAVPLDNFYADAAAGTLPEFSF
FT                   VDPSCCGVGTNSMHPTGLVSEGEALIKDVYDAVRSSPQWEETLLILTFDETGGFHDHVP
FT                   PPLATRPDDLTYTEIAPSGEKYTFSFDRLGGRVPTLLISPWVAKGQVEQKGTNSDGKVV
FT                   SYSASSILRTLGYLWDFEPFTPRVKSSPSFEHLIHNTARTDTPVKLPVPKAFRKMEI"
     atgaaattca gtgcccttct tggtctgttg acctttgcgg cggcggtctc tgctgatata        60
     aaggatcagc aatcccctct ttcttcgcct tccatcgcca atctgaagag caagatcaag       120
     aatgttgtca tcttggaaat ggaaaaccgc tctgtggaca acctactcgg cgggcagact       180
     atcaagggac tggataaccc tatcaataac ggccctttct gcaacccgta caacttgacc       240
     gatccttcag ctggcacggt gtgcagctcc gccaaggact ttgactctgt tctagatgat       300
     cctgatcact ccgtgactgg aaacaacatc gagttctatg gcagttttgt cccaaacaat       360
     gcccacattg cccagggcaa gctcactccc acccagcatg gctttgtgca tgagcagctg       420
     cgcagctatg gcgacgatgc cgacaaggct tatctggcca agcaggttat taactactat       480
     atcgaggacg aagtgccggt aatgactacg ctggtgcaga actacctcgc cttcaaccac       540
     tggcattcgg atcaccccgg tcctaccaat cccaaccggg cctttgtact ctcaggcaca       600
     tccgctggtc acgggtacaa cgatgagacc ttcaacccag atatccacgg cctcactcac       660
     cgttccatct tccagcagct ctcagagacc aaccacacct ggaaaaacta ctacacaagt       720
     cctagtatgg ttgacgccta cttcttcaac tggactttta caagcggcaa ctccgacaag       780
     gcagtccccc tggataactt ctacgctgat gcggcagccg gcacactccc agaattctcc       840
     ttcgttgacc cgtcctgctg cggcgtgggc acgaactcca tgcacccaac cggcctcgtc       900
     tctgaaggcg aagccctcat taaggacgtg tatgacgcgg tccgctccag tccacagtgg       960
     gaagagacgc tcttgatcct cacatttgat gagacagggg gcttccacga ccatgttccg      1020
     cctccgcttg ctacccgccc ggatgacctg acgtacaccg agatagcgcc gagtggcgag      1080
     aagtatacgt tctccttcga ccgtctcggt ggtcgcgtcc cgactctctt gatctcgccg      1140
     tgggttgcta agggtcaggt cgagcagaag ggcactaact cggatggcaa ggtcgtgtcc      1200
     tactctgctt cttcaatctt gcgcactctc ggctatctct gggatttcga gcctttcacg      1260
     cctcgtgtta aatcttcgcc ttcgtttgaa catcttattc ataacacagc gcgcactgat      1320
     acccctgtta agttgcctgt gccaaaggcc tttagaaaga tggagattta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page