(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE471

PENCW_10.PE471       Location/Qualifiers
FT   CDS_pept        join(1126047..1127790,1127854..1128213,1128281..1128487,
FT                   1128563..1128786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951944"
FT                   /orf_name="Pc13g04710"
FT                   /product="Pc13g04710 protein"
FT                   /function="DNA binding"
FT                   /biological_process="spermatogenesis"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91540.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007283"
FT                   /db_xref="InterPro:IPR000221"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniParc:UPI0001830D17"
FT                   /db_xref="UniProtKB/TrEMBL:B6H242"
FT                   /transl_table=1
FT                   /translation="MSYTYRDRERDWDDTRPVTIKRYVVSPEDDRRDFMSRYDDSFGGE
FT                   RELVIRRKSDREEPVTVSRYEREVEYEPPTRYERDHYDREYLHPTYRPHSRSMDSLERM
FT                   EQSPTATAIATRKQSVLIREARNPYISPRESDYDVVRRSEADEDPYYYHRHRRLREYDE
FT                   HRSRRELSPDDSVSQTSRRRRGDRDHDYSSDDSMVYIRKETRDYDDHPHHRRHMAEGAL
FT                   VGAGAAELLRSRSKKDGEVSHGASRIGKTLGAGALGAVAVNAASHARDYYHRSKSRHRS
FT                   HSFEDDRASHRHSRHGRSRHSRSRSRSHSHSRTKTLLEVGVGAAALAAGVAALRSKSKG
FT                   GDRKSRSRTRSRSRAASRGRSEKDGEHGERSMSERRKHMAGAGLAGAAVAGLVEKVRSH
FT                   SRSRKGERSRSRSRVRQALPIVGAGLATAAATGLYEKQKSDKDEKDGSSRGRHRSRSRS
FT                   RAPSQSYPDPARDSAGLIEYGNDPVTGSIPSEHYYGQPGAPYYEAQEAYGPRRHSRSRS
FT                   RSRSRARYTSSSDSDREGRRRRSKKHRSRSRDLAGAALGATGLGYAAHKYNERRKSKER
FT                   EREHSKHDDVHRDPYEESYDPEPYPPSPQRAPGAPPMADPHYYPNSNYFPPPPGDSTYN
FT                   LGGGTPVSYNPADYPPPPGAAPPQPYAYGAVPPGGPGPDQYAPRPRRAEDNVSSSTLPT
FT                   DANHVHKGLNIHPFPTSPPRSSSQPPQVSKSVAFDLTELPRDPGYETDESDSTVEPYSS
FT                   LHRGGRTHRRDRDRDREHYYSSHPASSHHRHHPSASKSQEGRDQNKVSETDSDSTIDLP
FT                   NRFDGQGRLLPERDPAVDKFEDLVNRFTKVLF"
     atgtcgtaca cttacagaga ccgcgaacga gactgggacg acacccgtcc cgtcacaatc        60
     aagcgctacg tcgtctctcc tgaagacgat cgtcgagact tcatgtcgag atacgatgac       120
     tctttcggcg gcgagcgcga gctggtgatc cggcgcaaat cggatcgtga agagcctgtg       180
     accgtctcgc gttacgagcg agaggtggag tatgagccac ccacacgcta cgagagagac       240
     cactacgatc gtgagtactt acatcccacc tatcgtccac actcccggtc catggattcc       300
     ctggaacgaa tggagcagtc ccctactgct actgccattg ccacccgaaa acaatccgta       360
     cttattcgtg aagcccgcaa tccgtatatc agtccccgtg aatccgacta tgacgtcgtg       420
     cgccgctccg aggccgatga agacccatat tactaccacc gtcaccgtcg acttcgcgag       480
     tacgacgaac atcgctcccg acgtgagctg agccctgatg attccgtttc tcagaccagt       540
     cgccgtcgtc gcggtgatcg tgatcatgac tacagcagcg atgatagcat ggtctacatc       600
     cgaaaagaaa cccgcgacta tgacgaccac cctcatcacc gccgccatat ggcagagggt       660
     gcattggtag gtgcaggtgc ggccgaactg ctccgcagcc gcagcaaaaa agatggcgaa       720
     gtcagccatg gcgccagccg catcggtaag actcttggtg caggtgctct tggtgcagtc       780
     gctgtgaatg ctgcatcgca tgctcgcgac tactaccacc gtagcaagag ccgccaccgt       840
     tctcattcct ttgaagatga ccgtgcttcc catcgtcaca gcagacatgg ccggagtcgt       900
     cacagccgta gccgcagccg ctcccactcc cactctcgta ccaagacatt gctcgaggtg       960
     ggagttggtg ctgcggcctt ggctgctggt gtggctgcat tgcgtagcaa gtcgaaaggt      1020
     ggagaccgta aaagccggtc ccgcactcgc tcccgttctc gggctgctag ccggggtcgt      1080
     tcagagaagg atggagagca tggtgaacga agcatgtctg aacgccgcaa gcacatggct      1140
     ggcgctggtc tggccggtgc ggccgtggct ggtctggttg aaaaggtccg cagccattcg      1200
     cgctctcgaa agggtgagcg ctcccgttcc cgcagccgtg tgagacaagc tcttcctatt      1260
     gtgggtgccg gtcttgctac tgctgctgcc accggcctct acgagaagca gaagagtgac      1320
     aaagatgaaa aggacggttc gagccggggc cgccatcgct caaggtctcg cagccgcgcc      1380
     ccgtcacagt cttatcccga cccagctcgc gactcggccg gtctgatcga atacggcaac      1440
     gacccagtca caggtagcat cccatctgag cactactacg gccagcccgg tgcgccctac      1500
     tacgaagcac aggaagcata cggtcccaga cgtcatagcc gcagtcgcag tcgcagtcgc      1560
     agccgagccc gctacaccag ctcatctgat tccgaccgcg aaggtcgccg ccgacgaagc      1620
     aagaagcacc gcagtcgctc gcgagacctc gcgggcgctg ccctgggcgc aacagggctc      1680
     ggctatgccg cacacaagta caacgagcgt cgcaagtcca aagagcgcga acgtgaacac      1740
     tctaagcatg atgacgtcca ccgtgatcct tatgaagaat cctacgaccc agaaccatac      1800
     ccgccttccc cgcaaagagc cccgggcgcc ccgcccatgg ctgaccccca ctactacccc      1860
     aacagcaact atttcccccc gcccccgggc gactcgacct ataacctggg cggcggtacc      1920
     cctgtttcct acaacccggc agactaccct cctccaccgg gcgctgcccc gcctcagcct      1980
     tacgcatacg gcgctgtgcc accaggaggg ccgggacccg atcaatacgc acctcggcca      2040
     cgtagggctg aagacaatgt gagcagctcc actctaccta ctgatgcaaa tcatgtgcac      2100
     aagggtctaa acatccaccc cttcccgacg tctccacccc ggtcaagtag ccaaccgcca      2160
     caagtctcga aatccgtcgc tttcgacctg acagagctcc cgcgcgatcc tggctacgag      2220
     accgacgaaa gtgactctac cgtcgaaccg tactcatctt tgcatcgtgg aggtagaacc      2280
     caccggcgcg atcgagatcg agatcgagag cattactact cttcccatcc tgcttccagt      2340
     caccaccgac atcatccatc agcttcgaaa tcccaggagg gacgagacca gaacaaagtc      2400
     tctgaaacag actctgactc aaccatcgac ctacctaacc gctttgacgg gcaaggccgt      2460
     cttcttcctg agcgggatcc tgctgtggat aaatttgagg acctggtgaa taggtttacc      2520
     aaagttctgt tctag                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page