(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE472

PENCW_10.PE472       Location/Qualifiers
FT   CDS_pept        complement(1129952..1132675)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951945"
FT                   /orf_name="Pc13g04720"
FT                   /product="Pc13g04720 protein"
FT                   /protein_id="CAP91541.1"
FT                   /db_xref="UniParc:UPI0001830D18"
FT                   /db_xref="UniProtKB/TrEMBL:B6H243"
FT                   /transl_table=1
FT                   /translation="MAAESERPPHLNGTPGRSSGPKGAEAPSDPTHRSASESGMMERSL
FT                   VTPQTQPMSQVPKLFPTPPSASASASTTNSAVSSREPSPVRHSSRTYTPTYNPSSPTRV
FT                   SSQSRKTSQDRSSPIRHSNGLTSGPPTSSPTPNLQRSSSSPVRSLGLSVPVDSPANVPG
FT                   PEKSNMPSWAANRRTDLDSTLPNTSQKRSSLPLEDFTPKPDRNTTRTVARGVSGQGSSL
FT                   ETVEEMASNPSTPSSETPTKPVIPEESRLHRIDEDPTPRAPHQTLGSGSDSGENRSSEP
FT                   KEETRPQAPSAAKTTKTLMSQRSTTSLSASARGKPADGSVRNMIVETETVSSIPQVSMG
FT                   VGNGERGNASRAEQGTLRMKPSNETIRPRKEKKKNRRPNALLTTGPVTSKADIFEARVA
FT                   NAVDEADVSDSDETFVYDSNPPDPYPSRPPRYHSRTPSATSMASQAEQLAGRTRGLRDT
FT                   SHGVTGKRSMKFTNTNPYNNGSIEGDGVEIDMASRSTRPDGSGTITPRHHNLGRLHGRN
FT                   GMHPNLFDNDSAHSQSQSQKSPRHFIGNSYRHSRHRLSPNYRTIGGSKKSGEYDYEAEG
FT                   ADDERTPLVGTPRTMHSRGGRRPNSASLRQMQYMAQRERGVFARFGSCAIIFLLLLIVA
FT                   GGATSFIVAATQPLLDVQVIAIQNVLASEQEIMLDLNVQAINPNLFPVTIDDTDVNIFA
FT                   KSRYVGTDKFWREHGDLDNFPRVEQSRRRWQLSQAVRCLGNMDCVKEAMSSQPDPHTTD
FT                   GVDKGTDPPTDPEGDPRSMLLGRVFHFDSPLSFESSPWNHLTSSSKGQIRLPRPGNKTE
FT                   AGGTERWERVLQHPFELTVRGIIKYQLPLSSRYLSASVSSSIKVVPDTDDNDPEQTPPS
FT                   NDTVRISVPQRSAPPIRLPLDTRSTGSGDSRRPFTA"
     atggctgcgg agtccgagag gccgcctcac cttaacggca cccctggtcg atccagtgga        60
     ccgaagggtg cagaggcgcc gtcagaccct acgcaccgat cggccagcga aagtggcatg       120
     atggaacggt ctctcgttac acctcagact caacccatgt ctcaggtccc taaacttttt       180
     cccactcctc cttccgcttc cgcttccgcg tctaccacga actccgctgt ttcctcccgc       240
     gaaccctccc cggtccgaca ttcttcgcgt acctacactc ctacctacaa tccttcctcg       300
     cccacccggg tatcctcaca atcgcgaaag accagtcaag accgatccag tccgatccga       360
     cactctaacg gcctgacatc cggcccacct acaagctcac caacaccgaa tcttcaacgt       420
     tcctcctctt ctccagtaag gtccctgggt ctctccgttc ctgtcgactc gccggccaat       480
     gtccccggtc cggaaaagtc caatatgcca tcatgggccg cgaaccgtcg cacggatctg       540
     gattcgacac tcccgaatac ttcgcagaaa agatcttcat tgccgttgga ggatttcaca       600
     cctaaaccgg accgaaacac aactcgcact gtcgctagag gtgttagtgg gcaagggtcc       660
     tccctggaaa ccgtcgaaga gatggcaagc aatccctcta ctccgtccag tgagactcct       720
     accaagccgg tgatcccgga ggaatcacga ttgcaccgga tcgacgaaga cccgacccca       780
     cgtgctccgc atcaaacttt agggagtggc agtgacagtg gtgagaatcg aagttcggaa       840
     ccaaaggaag aaacccgtcc acaggcgcct agtgcggcca aaacaaccaa aactctgatg       900
     tcacagcgat cgacaacatc actcagtgct agtgctcgtg gaaagcctgc cgacggctca       960
     gtgcgcaaca tgattgtaga aacagagacc gtcagttcga tcccgcaagt ttccatggga      1020
     gtggggaatg gtgagcgagg caacgcttcc cgcgcagaac agggtacact tcgcatgaag      1080
     ccttccaatg aaaccattcg tccgcgcaaa gaaaagaaaa agaaccgtcg acccaatgcc      1140
     cttcttacga caggccctgt cacaagcaaa gccgacatct tcgaggctag agtggccaat      1200
     gcagtggatg aagccgatgt ttcagactcc gacgagactt tcgtttacga ctcgaacccg      1260
     cctgatccat atccttctcg accacccagg taccattctc gaactcctag tgcgacctct      1320
     atggcgagtc aagcggagca gttggctggt cgtacccgag ggttgcggga tacttcccat      1380
     ggcgtgacag gcaaacgcag catgaagttt accaacacta acccctacaa caacggcagc      1440
     atagaaggtg acggtgtcga gatagatatg gcttcgcgct ctactagacc ggatgggagt      1500
     ggaaccatca ctccccggca tcacaatttg ggccgccttc atggacgcaa cggcatgcac      1560
     ccaaatcttt ttgataacga cagtgctcac tcacagagcc aatctcaaaa atctccccgt      1620
     catttcatcg ggaatagcta tcggcattct cgccaccggc tgtctccaaa ctacagaact      1680
     attggcggtt ccaagaaaag cggcgagtac gactatgagg cagagggtgc agacgatgaa      1740
     cgtacaccgt tggtaggcac accacgtaca atgcacagtc gcggtggtcg acggcccaac      1800
     agtgcaagct tgcggcagat gcagtacatg gcgcagcggg agcgcggggt tttcgctcga      1860
     tttggctcgt gcgctattat cttccttctg ttgttgatcg tcgctggcgg tgccacctca      1920
     ttcatcgtgg cggcaaccca accccttcta gatgtccagg ttattgcgat tcaaaacgtg      1980
     ctggcttcgg aacaggaaat tatgttggat ctgaacgtgc aagccatcaa tccgaacctg      2040
     ttccctgtga ccattgatga taccgatgtc aacatattcg cgaagagtcg atacgttgga      2100
     accgacaagt tttggcggga gcacggtgat ctggataact tcccacgcgt ggagcaaagc      2160
     cgacgtcgct ggcagttgtc acaagccgta aggtgtctag gcaatatgga ctgtgttaag      2220
     gaagccatgt ctagtcaacc tgacccccac accaccgacg gggttgacaa gggaactgat      2280
     cctccaaccg atccagaagg cgacccgcga tcaatgttgc ttggccgcgt gttccacttc      2340
     gattccccac tatcttttga atcatctcct tggaatcatt tgacttccag ctccaaagga      2400
     cagatccgtc tgccccgacc aggaaacaaa actgaggcag gaggcacaga gcgctgggag      2460
     cgagtcctcc aacacccctt tgagttgact gtccgcggta tcatcaaata ccagctccca      2520
     ctcagctctc gctacctctc ggcatctgtt agctccagca tcaaggtggt gcccgatacc      2580
     gatgacaacg acccggagca aacacctccg agcaatgaca cagtacgaat ttctgtgcca      2640
     caaagaagcg caccacccat tcgccttcca ctcgatactc gatccactgg atcaggggat      2700
     tcgagacgac cttttacggc ataa                                             2724
//

If you have problems or comments...

PBIL Back to PBIL home page