(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE473

PENCW_10.PE473       Location/Qualifiers
FT   CDS_pept        join(complement(1134388..1134430),
FT                   complement(1133616..1134346))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978593"
FT                   /orf_name="Pc13g04730"
FT                   /product="Pc13g04730 protein"
FT                   /protein_id="CAP91542.1"
FT                   /db_xref="UniParc:UPI0001830D19"
FT                   /db_xref="UniProtKB/TrEMBL:B6H244"
FT                   /transl_table=1
FT                   /translation="MTMVAWRVYLFQSGDLESGRRERETDYMLFHIDPVDFTHDFLDEA
FT                   TAYFPRLRLSFDIPHKLLLITIPSPEHAAAIGALSEETRRDLDSMGHGLSHAIKSYPGG
FT                   GTRAQNGKGKDADIAFGPRRRAVGERANGNEKRYTVVAEIAISETETKLKRDTDFWLDP
FT                   LCGNANLVITITASRKLAYIKIDTWQRVNDQAHCTGSLSITKTTQGRVKVTGPLRIPFD
FT                   ALFDRAPTSPAERAISLSVQRLQSLAEAIWEDQGI"
     atgacgatgg ttgcctggag ggtctacctc tttcaatcag gagatcttga atctggcagg        60
     cgcgaacgtg aaaccgacta tatgcttttt catattgacc cggtagactt cactcacgac       120
     ttcctcgacg aagcaacggc ttattttcca cgactgcgtc tttcttttga tattccacat       180
     aaactactgc taataaccat accgagccct gagcacgcag ctgcgattgg tgcccttagt       240
     gaagaaacgc ggcgagatct cgactcgatg ggccatggtc tgtctcacgc gatcaagtcc       300
     tatccagggg gcggcacccg tgcccaaaac ggcaaaggaa aagatgctga tatagcattt       360
     ggcccaagga ggcgagcagt aggagagcga gcaaacggaa acgaaaaaag atacaccgtt       420
     gtcgctgaga tcgctatctc tgagacggaa actaagctga agagagatac tgatttttgg       480
     ttggaccccc tttgtggcaa tgcaaatctg gtcataacga tcacggcaag cagaaaactt       540
     gcctacatca agatcgacac ctggcaacgg gtgaatgacc aagcccactg tactgggagt       600
     ctgtcgataa caaagaccac gcagggcaga gttaaggtca ccggtcccct gcgcattcca       660
     tttgatgcgt tatttgacag agcgccaaca agtcctgcgg aaagagctat atctctttcc       720
     gtgcaacgtc ttcagtccct cgcagaggct atctgggagg accaagggat ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page