(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE474

PENCW_10.PE474       Location/Qualifiers
FT   CDS_pept        join(complement(1136079..1136762),
FT                   complement(1135956..1136030),complement(1135556..1135900))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672737"
FT                   /orf_name="Pc13g04740"
FT                   /product="Putative uncharacterized protein Pc13g04740 "
FT                   /protein_id="CAP91543.1"
FT                   /db_xref="UniParc:UPI0001830D1A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C3"
FT                   /transl_table=1
FT                   /translation="MDAAEEYAELMNVNKNEGKYLFYPQRFSRLHPGSVGFFNRHGVWS
FT                   EITDLCEEGRPKRDGYENPSRPLKLDQPTESFWKTRSSGSEAEMNFGLTGGLSGALSAA
FT                   PVDVSAEAKNKSGSSGQAALITESAVRHETLEAPFQGPIQKWVEKNAKALVDSDYGEDV
FT                   ATYGLWAIQAAWVTKECAITLNSAKNREANLGFDVGATGLGKVGASGGSLAKLEQKGWT
FT                   AYEAKEGDQGLVIAFGGFKYELHKFFKWRSNPLKITDTRMDERPETIQVTPLFTKPILD
FT                   ENGVETGFEIFKHILNENGEKIGEEKVDIGVQGKEGEGNERRDAEREKEEQERQEKPEE
FT                   KEDSMIQCDTVGISETALEADSKAKQA"
     atggacgctg ccgaggagta tgccgagctt atgaacgtca acaaaaacga gggcaaatat        60
     ctattctacc ctcagcggtt tagtcgactt caccctggct cggttggctt ctttaacaga       120
     catggggtgt ggagtgaaat caccgatcta tgtgaggaag ggcgcccaaa gagagacgga       180
     tacgagaatc ccagcaggcc ccttaagctc gaccaaccta cggaatcctt ctggaaaaca       240
     agatcctcgg gcagtgaggc agaaatgaat ttcgggctca ctggaggact ttctggggct       300
     ctctctgccg ccccagtgga tgtatccgcc gaagccaaga acaaaagtgg ctcatctgga       360
     caggcggcac tgattaccga gtctgcggta agacatgaga cgctggaagc tcctttccaa       420
     gggccgattc agaagtgggt cgagaagaat gcaaaggctc ttgtggactc ggactatggt       480
     gaagatgttg caacgtacgg tctctgggca atccaggctg cctgggttac gaaggagtgt       540
     gcgatcactt tgaatagtgc caagaatcga gaggccaacc tggggttcga cgttggggcg       600
     accggccttg gtaaagtcgg ggctagtgga gggtcgcttg caaaactcga acagaagggt       660
     tggactgcat atgaagcgaa agagggagac cagggattag tgattgcttt cggcggattc       720
     aaatatgagc tccacaaatt ctttaaatgg agaagcaacc ccctcaaaat taccgacact       780
     aggatggatg aaagacctga gacaattcag gtcactcccc tgttcacgaa gcccattctt       840
     gatgagaacg gagttgagac tggctttgag attttcaagc atatattaaa tgagaatggg       900
     gagaaaattg gcgaggagaa ggtggacata ggagtgcagg gaaaggaagg agaaggaaat       960
     gagagaagag atgcagagag ggaaaaagaa gaacaggaga ggcaggaaaa gcctgaagaa      1020
     aaagaagatt ccatgatcca atgtgatact gttgggatca gtgaaactgc tcttgaagcg      1080
     gattcaaagg caaagcaggc gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page