(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE475

PENCW_10.PE475       Location/Qualifiers
FT   CDS_pept        join(complement(1140390..1140868),
FT                   complement(1138261..1140321),complement(1137982..1138184),
FT                   complement(1137862..1137932))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951946"
FT                   /orf_name="Pc13g04750"
FT                   /product="Pc13g04750 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91544.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001830D1B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C4"
FT                   /transl_table=1
FT                   /translation="MDPPMIPIPGTASSRPPRSSHSSSPRKRPQHSDYPPADNNASHGL
FT                   MSGGRAPGTGPVPVPETSPANKTRSNPPADNAAGKPSKSSKRKKNRNRKRRNRHQSFIP
FT                   PSREESHDSPTEISDAGGVRDSMEADRPTSRDKSFFKLGRNLSNTSLESDALLDHRDQP
FT                   SMRPRRDSRLASSFRPSSLTSNVFRSNDGQSRNTPRGTRSQQHNGDSDEEDTNDRTPLM
FT                   RPVSGQIPGHNRYGTDTRPGLFSSRARHPSAQTISSECSPKDDRSPLYSPCVDRDYDVN
FT                   NPPSIPGSPKLGPEMNYEDAVVTGADWDFSMARSLDNRKDSLNPLNDTLIDIEGNGSHP
FT                   HSAPSSSPGSPLLSPHQELRRRRTVAVPAEEDVCFPTEAISELGDEGPRQMRDEVGERR
FT                   RRRHRRWPDLSVLEEWSREEKEERNGDIRVKRISEPVLVEGRLRPQYTGWRREEDEAPY
FT                   RFTYFNEEFPSTIHAQTISELVQPGGSFRDLFIPDPPELEDSSEDEDDEDESFVENPAF
FT                   NNSTQAPNKPTYHSDNQSQGQGHQTNVNPHMTTQTVAPNGRSTSDLMTGNAPPVRGPSR
FT                   LSVISEGRPDSHRELSPAPSNTPFNNTPNTKPKRYGPRPTFWLDVLSPTDGEMRTIAKA
FT                   FGIHALTAEDIMMQEAREKVELFRSYYFVNYRTFEQDVNSEDYLEPVNMYVVVFREGVI
FT                   SFHFSQTPHPANVRRRIRQLMDYLILSSDWISYALIDDITDVFGPLIQAIEDEVDEIDE
FT                   MIMQMHSSSKEVSSNDSVLPSFAPGEMLRRVGECRKKVMGLYRLLSNKADVVKGFAKRC
FT                   NEQWEVAPKSEIGLYLGDIQDHIMTMTGNLTHYETILSRAHSNYLAQINILMNERQEHT
FT                   ADVLGKLTVLGTIVLPMNIICGMWGMNVKVPGQDIDSLTWFWCITAGLCVFAFVSVWTA
FT                   KRVYKIV"
     atggatccgc ccatgatccc aatacctgga acagcgtctt ccagaccgcc acgttcgtcg        60
     cattcgtcta gcccaagaaa acgtccacag cacagcgatt acccacctgc tgataacaac       120
     gctagccatg gcctaatgag cggcggtcgg gccccaggca ctggtccggt acccgtcccg       180
     gagacgtcgc cagccaacaa gacccgctcc aacccccccg ctgataatgc tgctggcaaa       240
     ccctccaagt cctccaaacg caaaaagaac cgcaatcgca agcgtcgcaa tcgacaccag       300
     tcttttattc cacctagtcg ggaggaatcc catgatagcc ctacagagat ttcggatgct       360
     ggaggtgtta gggactcaat ggaggccgat cggccaacct cgagggacaa gtcgttcttc       420
     aaattgggcc gcaatctaag caacacaagc ttggagagcg atgccctgtt agatcatcgg       480
     gaccaaccct cgatgagacc tcgtcgtgac agtcgccttg catcgtcatt ccgccccagc       540
     tccctaacat ccaatgtctt ccgatcaaac gatgggcaat ctcgcaacac cccgagaggg       600
     acacggagcc aacaacataa tggtgatagt gacgaagagg atacaaatga tcggacgcca       660
     ttgatgcggc cagtttcagg ccagatacct ggccataatc ggtacggaac agacactcgc       720
     ccgggtttgt tctcatcgcg tgcccgacac ccctctgctc agactatatc ctcggaatgt       780
     tcgccaaagg atgatcgcag cccactctat tctccctgtg tagatcgaga ctacgatgtc       840
     aacaacccgc cgtcgattcc gggttctccg aaattgggcc cggagatgaa ttatgaagat       900
     gctgtggtaa caggagctga ttgggacttc tcaatggctc ggtcattgga taatcgcaag       960
     gactctctga accccctcaa cgacactctg atcgatatag agggaaatgg atcgcaccca      1020
     cattctgcac catcctcttc gcctgggtca ccgctgcttt ccccgcacca agaattgcgg      1080
     cgacgccgga ccgtggcagt accagcagag gaagacgttt gcttccctac cgaggcgata      1140
     tccgaattgg gagacgaggg accaaggcaa atgcgagatg aagtcggtga acgtcggcgg      1200
     cgtagacatc ggcgttggcc cgatctctcg gtgctggaag aatggagccg cgaggagaaa      1260
     gaggagcgca atggagacat tcgagtcaaa aggatcagtg agcctgtgct cgtcgaaggc      1320
     cgattgcgcc ctcagtatac aggttggcga cgcgaagagg atgaggcgcc ttatcggttc      1380
     acgtatttca acgaagaatt tccgagcacc attcatgccc aaactatctc cgagctggtc      1440
     cagccaggtg gtagcttccg cgatctgttt attccagatc cacccgaatt agaggattcc      1500
     tcggaagatg aggacgacga agacgaatca ttcgtggaga acccagcttt caataactca      1560
     acacaagcgc ccaacaagcc aacatatcac tcggacaacc aaagtcaagg gcaaggtcat      1620
     caaacgaacg tcaatcctca tatgacgact cagaccgttg ctcccaatgg aaggagtaca      1680
     agtgacctta tgaccggcaa tgctcctcct gtcagggggc cctcgcgttt atctgtcatc      1740
     agcgaaggac gcccagactc ccaccgagag ctttcgcccg caccttcaaa caccccattt      1800
     aacaacaccc ccaacacgaa acctaaacgg tacggtccgc ggccgacttt ctggctagat      1860
     gttctctctc caacagatgg ggagatgcgt acgattgcca aagcttttgg gattcacgcg      1920
     ctaacggcag aggacattat gatgcaagaa gctcgagaga aagtcgagtt gttccgcagc      1980
     tactattttg tgaactaccg cacttttgag caagatgtca acagcgagga ctacctcgag      2040
     ccagtgaaca tgtatgtggt ggtcttccgc gaaggcgtga tatccttcca tttctcgcag      2100
     acaccccacc cagccaatgt gcggcggcgt attcgccagc tgatggatta cctgatcctc      2160
     agctccgact ggatttcata cgcactgatt gatgacatta ccgacgtctt cggtccgctg      2220
     atccaagcta ttgaagatga ggtcgatgag atcgacgaga tgatcatgca gatgcactct      2280
     tccagcaagg aggtgtcgtc caatgacagt gtgcttcctt cattcgcacc aggagaaatg      2340
     ctccggcgag tgggagaatg ccgcaagaag gtcatgggac tgtatcgact tctcagcaac      2400
     aaggccgatg tagtcaaggg ctttgccaag cgttgcaatg agcagtggga ggtcgcaccg      2460
     aagtcagaga ttggtctgta cctgggtgac attcaggatc acattatgac gatgacgggt      2520
     aacctaacgc actatgaaac gatcctttcc cgcgcacact ccaattacct cgcacagatc      2580
     aacatcctca tgaatgagcg tcaggaacat actgccgacg tactgggtaa gctgactgtt      2640
     cttggtacga ttgtcctacc gatgaacatc atctgcggca tgtgggggat gaacgtcaaa      2700
     gtaccgggtc aggacattga tagtctgaca tggttctggt gcattactgc cggactatgc      2760
     gtgtttgcat ttgtatctgt ttggactgct aagagagtct acaaaattgt atag            2814
//

If you have problems or comments...

PBIL Back to PBIL home page