(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE476

PENCW_10.PE476       Location/Qualifiers
FT   CDS_pept        join(1141701..1141788,1141865..1142616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000059368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951947"
FT                   /orf_name="Pc13g04760"
FT                   /product="Pc13g04760 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91545.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830D1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C5"
FT                   /transl_table=1
FT                   /translation="MAPPTCRSEILAHLRRQIEDGKPIVGAGAGIGLSAKSVEAGGADL
FT                   VIIYNSGRFRMAGCGSLAGLMPYSNANEVVVEMAAEVIPIVQNIPVIAGVCGTDPFKHI
FT                   PRFLKQLRDLGFAGVQNFPTVGLIDGNFRANLEETGMGYGKEVEMVRQAAELDILTTPY
FT                   VFNVEEAEAMTKAGADILVAHMGLTTSGLIGAKTGKTLDQCVVEIQAMRDAAVQINKDV
FT                   IVLCHGGPIAAPEDAKFVLDRVQGLHGFYGASSMERLPVEVAIRDTTAEFKKIALKR"
     atggctccac ccacttgtcg cagcgagatt ctcgcccacc tacgccgtca aattgaagac        60
     gggaagccca tcgttggagc cggagccggc atcggtctct ccgcaaaatc ggtcgaggcc       120
     ggcggcgcag acctagtcat catatacaac agcggtcgct tccgcatggc ggggtgcgga       180
     agtctcgcgg gattgatgcc ctacagcaac gccaacgagg tggtggtcga aatggccgct       240
     gaagtcatcc ctattgttca aaatatcccg gtgattgcgg gtgtctgtgg tacggaccca       300
     ttcaagcata tcccgcggtt cctgaagcag ctgcgggact tgggatttgc tggggtgcag       360
     aacttcccca cggtgggact gatcgatggc aacttccgtg ctaacctgga ggagactggg       420
     atggggtatg gtaaagaggt ggagatggtg cggcaggcgg ctgagttgga tattctgacg       480
     acgccttatg ttttcaatgt tgaggaggcc gaggctatga cgaaggctgg ggcggatatc       540
     ctggtggcac atatgggtct gactacttct gggctgatcg gggcgaagac tggaaagacg       600
     ttggatcaat gtgttgtgga gatccaggca atgcgggatg cggcggtgca gatcaataag       660
     gatgtcattg tgctgtgtca cggtgggcct attgctgctc cagaagatgc caaattcgta       720
     ttggataggg tgcagggctt gcatggcttc tatggagcca gttcaatgga gcgacttcct       780
     gttgaagtag ccatcaggga caccactgct gagttcaaaa agattgcctt gaagaggtag       840
//

If you have problems or comments...

PBIL Back to PBIL home page