(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE478

PENCW_10.PE478       Location/Qualifiers
FT   CDS_pept        complement(1144707..1146188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951948"
FT                   /orf_name="Pc13g04780"
FT                   /product="Pc13g04780 protein"
FT                   /protein_id="CAP91547.1"
FT                   /db_xref="UniParc:UPI0001830D1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C7"
FT                   /transl_table=1
FT                   /translation="MQHLQDIETRLDQLISENRLLIAARDEAEDKLRNTTVARRKSDRA
FT                   LNTRDGDLRDRESEVEQLKNSVEWLQKEISRLTQENEGLTASNSALAAAHAAEVNSVRE
FT                   SSTRELADLQSQHNQLSSQIEDRVRQEIESALAQKDIELRRLRTELEEARDKVKELQQQ
FT                   IAASVHDNALVFRDEEYFDAACQKLCGHVQSWVVRFSKHNDKRRCRPLSELQDEKIADR
FT                   FDNALLDGSDPDAYLSDRVRRRDVFMSVVMTMVWEYIFTRYLFGMDREQRQKLKSLEKQ
FT                   LGEVGPARAVHRWRATTLTLLSRRPAFAAQRESDTEAVTLEIFQTLSRILPPPSHVESQ
FT                   LLDNLRKIMRVAVNLSLEMRTQLAEFIMLPPLQPEYDTNGDLARQVYFNAALMNERSGL
FT                   TNDNGELEAQQSIVRIVLFPLVVKKGNDVGEGDDEVVVCPAQVLVARPSKDKKVSRMMS
FT                   GDRMSIDPTRSVHSIVQSITHSVAPSSMMDMSNVI"
     atgcaacact tgcaagacat cgaaacccgc ctcgaccagc tcatctccga aaaccgccta        60
     ctgatcgccg cccgcgatga ggccgaagat aagctacgga ataccactgt cgctcgtcga       120
     aagagcgacc gtgcgctcaa cacccgcgac ggagatctgc gcgatcggga atcggaagtg       180
     gaacaattga agaactcggt ggaatggctg cagaaggaga tctctcgtct gacccaagag       240
     aacgagggcc tgaccgcatc caactctgct ctcgccgccg cccacgcagc cgaggtcaac       300
     tccgtacgcg agtcgtccac acgtgagctt gccgacttgc agtcgcaaca caatcaactc       360
     tcgtcccaga tagaggatcg cgttcgacaa gagattgagt cagctcttgc acaaaaagac       420
     attgaactgc gccgtctgcg caccgagctt gaggaggccc gtgataaagt gaaggagctc       480
     caacaacaaa tcgcggcctc ggtacacgac aatgcccttg tcttccgcga tgaagagtac       540
     ttcgatgctg cctgccagaa actgtgtggc catgtccaat cttgggtcgt gcgcttctct       600
     aagcacaacg ataagcgtcg ctgtcgccca ctcagtgaac tgcaagacga gaagatcgct       660
     gaccgcttcg acaacgctct cctcgacggc tccgatcccg atgcctacct gtccgaccgt       720
     gtccgccgcc gcgatgtctt tatgtcggtt gtcatgacaa tggtctggga atacatcttc       780
     acccgttatc tcttcggcat ggaccgggag caacgtcaaa agctcaagtc tcttgagaaa       840
     caattgggcg aggttggccc agcccgtgct gtgcaccgct ggcgagccac cactctcaca       900
     ctgctgtccc ggcgaccggc ctttgctgcg caacgtgaga gcgatacgga ggctgttact       960
     ctggagatct tccaaaccct atcgcggatc ctccctcccc cgtcgcatgt tgaatcccaa      1020
     ctcctcgata acctccgtaa gatcatgcgg gtagcagtca acttgtcctt ggagatgcgc      1080
     acccagctag ctgaattcat catgctgccg cctctgcagc cggaatatga taccaatggc      1140
     gaccttgccc gccaagtata cttcaacgcc gccctgatga atgagcgcag tggtctgaca      1200
     aatgacaacg gcgagctcga agcccaacag tccattgtgc gcattgtgct cttccctctt      1260
     gttgtcaaaa agggcaatga tgtgggcgag ggtgatgacg aggttgtcgt ctgccccgcc      1320
     caggtcctcg ttgcccgccc cagcaaagac aagaaagtat caaggatgat gagcggcgac      1380
     cgcatgtcca tcgatcctac caggtcggtc cacagcatcg ttcaaagtat cactcacagt      1440
     gtggcaccgt catctatgat ggacatgagc aatgtgatct ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page