(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE479

PENCW_10.PE479       Location/Qualifiers
FT   CDS_pept        join(complement(1157781..1157834),
FT                   complement(1150344..1157748),complement(1148703..1150172),
FT                   complement(1146334..1148429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825424"
FT                   /orf_name="Pc13g04790"
FT                   /product="Pc13g04790 protein"
FT                   /protein_id="CAP91548.1"
FT                   /db_xref="UniParc:UPI0001830DD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C8"
FT                   /transl_table=1
FT                   /translation="MVLLHGFQHPRLAQLLLQRPRSQSTSPPATEKTLDLTPKSLSRPA
FT                   SPETSHPQGSRSPKQRRHSVAKSTTESPTAVPLHFRRPPTSPGLSRAVPVEQPAPIASP
FT                   GSPSQQRNRRPGSVEFRNSREIRPLWLVERHSLTKGEPETEEPLPSLPSSKTSSRVPSI
FT                   EDLKSLRDDDGLKSWEHVDLSHSITGNQRPTGLTISTEQANESHSGDVDLLGSQQATPT
FT                   AEHFQDAESRKERPRYEFHSPSELLRDPTALDELPPSPTLDALPSAEGSLVGVGSREQE
FT                   TQRALDALEGVSRPQSESETPTQDNNSLSSAAAEFAKGAGFAGVVDAVAIAAAREHDQS
FT                   RALPGDELAKPRSFGDIVDAAVAADGSSHDHDKAPVHEEALSEPVTAIEETAPAPLEPV
FT                   HPEMETAKESVPESTEQPVQSSDRQAQPETEVAPDESAQSSKKKNKKKKGKKNQAQDVE
FT                   LGGPEEPLAQEELSKEPVEEPAMDTPTVETVSAEPEVSVPEQSEPVEASRELGPGTGAD
FT                   EPVVEGAPVESAPVESAPIEPEVANPEQLEAEPIEASREVEIEPSVEAAQEPGVVTAPE
FT                   AESTEVPPAETELAEDAASSTKKAKRDKKKQKKKSKNESTSEEPTDDNVVAQPQDDTSA
FT                   SKEIEGQQEDSAHAPSEEIVATPLPEEMVTSTESTESTPDQTATSSAAIDAEQARSHPE
FT                   SGELVEPVEQVSTEEPVLPVSEGPSVPIELTPEPAFTDANETPITSATQPEAEEVSRSL
FT                   EQIEKPSEESTPEAPLDNTTPEITETPKEDTEGEDNFEEAVEEQIPQPAEEKEPPVEEP
FT                   PVEVATDAPAEASETKAEKRKNKKKKNRKSTAVEETDISTEMPAPETELPPERKEPEPE
FT                   QSAVVEPADTQSLPIGGEALPSDPEHLEQPTKDVDQPIETTIEESAATQEQEQAPLEAA
FT                   VDATPAVTEPVDPAGPSDELSQPAVVEVQPDAKLPAEEASREIPEPSAVETQPEAEVQA
FT                   EPQPEVAAEPEVALTAAQKKKAKKNKKKGKQSDSSIPDEKPAESTSPAPEAETAAEEIA
FT                   KETLLATEDTPVVAPPQESEMEVPVKVEQSIEPEQLPETEQIPEDLPALDEASPEPLPE
FT                   PMAEVTETQTTKEESNAPGEEPKAEESPAEPEVPMTAAERKRAKKAKKKQQKEQEESIG
FT                   SIAEDTKPVETVPAPDAESAEPSKDIAPAAEIDNVAPADSSAPVSSEPAETEQDVAPTS
FT                   TTEPEAAPVTEDTPLPTDPESIEPTKGIEAPAKAEPPVKDAAPSPEIGATEVAADVPLV
FT                   SEEAAAPVDVPQDLDQHNDVVKAEEPKSEDLTPAPTQEASADAPETDAPKAQEQSPEPE
FT                   VLMTAAERKKAKKNKKKQQKQEAVQLDEQPTREAEPTSAEEKSVEQSGDMLPESEPTPT
FT                   AETAAGVDDPTEPEAASDLEAETKPEEEQLQDVAKLDSEVVPGAPADEAISTPETAEQA
FT                   IDVQDGNKETAPEPTVEVPASTEDPQEAQKLDSAISEELALEKSLDDKPTESTSEPVAE
FT                   ETQPTESASPVVEQVEDEQAATSSKSKKKNKKKKRQSVAADEEQPAPAEEEVKPAPTEE
FT                   EPTPVPAENEPTEPAPSQELEQPSSGKDADTPMVTEEAPKAGEPVMDETTQPEAPADTA
FT                   ATEAAAEAAMTPAQKRKAKKDKKKRQSVAVQEEQPAAAEEESKAAPVGEEVKAAPEEEP
FT                   TPVPAENKHTESSSQDLEQPSPEKDAETPIVMEEAPKAEETTQPEAPADAAATETVEEA
FT                   AMTPAQKKKAKKDKKKRQSVIAEQEQPASVDEPKPELAEEKATPTPAEEDPTPESGQEE
FT                   LVEPTPTQEIEQSAVEKDVESPIMTEEAPKAEEIMQPEAPANAAATEALEEAAMTPAQK
FT                   KKAKKDKKKRQSVIAEEEQPASVDEPKPESAQEEPAKAESTRDTEHSTVDKDAQAPVMA
FT                   EEAPKAEEPSPEEATQPEGPADAAATEAAVETPAEEAMTPAQKRKAKKDKKKRQSVITE
FT                   EEQPTPVEEPTPESVQEKPTEPESTQEIEQPTLDEAAQTPIITEEEAPKVEEPSLENVT
FT                   PQDAPADAAATEPATEETMTPAQKKKAKKDKKKQQKSVAFDENATLTEDPKPEQDTSTP
FT                   EEKVESRDAPADLIVSEESAKELPVTEEAAEPAPEADISETREEPASSEESKDTTEHEP
FT                   TSTTAPDTPVPSEVKEPESAAALPEHPEQDAQTPPEFQNPSAQEPEVALTAAQRKKAKK
FT                   NKKKGKSVDLADNAPSATDAVQESEPKSEPVVQTSTDTPAETPELQDTPASELALPAEG
FT                   LEQDNTIEPEAPKAEEHETTEAVSDDVTKEETPEAKKTDNEPPATETILDAEPAPSQEV
FT                   EAVASSPTEPTEEAGMSAKERRKAAKKAKKRQSKNVDADTDAATSDPPSAPATEPTAPI
FT                   EAADSVEKVLTSTDTDAPGLSAVPASSPAEHDGKEHQSHGIETYDATAQDTTSTDKDMS
FT                   SQVEQTPIESPFLDYPPQPVLERDLSTEKEIEEMPVDVPIDVVPEAQIQESPVEEKASE
FT                   AAVSKKHKKKNKNKNKDIKQEEEAAVPEPASSTAEDKEQSEAGPSVEAEIQPEVKEIIE
FT                   PEPIAVAESVPIPEEQQPDQLQDIEETAAVQTTEDVDDTKEINVPEAEAAAPPTEDTTQ
FT                   PEAPVDVADIEATEDASMTPAQKRKAKKDKKKQRQSIIAQEPEAEAQPEEKTAPEAAET
FT                   SAQEAGITTEAAPGEIVTQDEAVPSAEEPTAQPIDAIQEAAKDPVTPSEDTEQHVLSQE
FT                   IENGERSLELPSTESKVEEGDKPTEQAAAAPAENPDDEQSSKKGLPEAGPEPEGESATV
FT                   PKKMSKKEKKKAAAAAAAAALVKEEKLAESQPEPKEALVSTPQAPEEVVDQSMVQEPQS
FT                   SETEDKPPPEAEKNPDEITGLPASRLKEDVLEQPAEALDSTEPLESEVKLEESTKELAE
FT                   EPAAAETITRKMSKKDKKRAKKQAQEEIIEPTSPPTEDHAQSEKNEAVISLGTLDTPSP
FT                   VEPTDQNTNNEPLDLERPAEKNDKKDEALVVADSQNLENAAVDQPVQPEVMPAMSKKMS
FT                   KKDKRKVKKNAGITEEVLAQQQEPQADVAELPTESEVQPAEPAAEKEIHQEPEHSAEAQ
FT                   PSLERELPIETPASIENEPIPDPGVQVKPTQPDEEPVVSEEVPLSRKASKKKAKKAQKA
FT                   NKSLDAEALAENTIADHHTTIVPFEEDQSKAEGLEVPDEKSAQDEEDWPAIDWQAKFEE
FT                   SQRSREADPEPEPDIPAPEPEIIGEFVDSSFREVSQDANEATEEDAWALPTSKKDKKKA
FT                   KKNKKQSQQTPPEAEGPSLEPFNDIEIEPPARTTTPGGSKIANLFPGLERGGFRRSALD
FT                   QQPRSLKDSAEEETTADLEANRDVAIPVLEAPPATTETKEIPRDFTSELPSSLERQIES
FT                   TISELKAHSETPTATEHGSIREPELPPEGDKSKDMPSSLSMEPSDERTRPTEPSSPTRL
FT                   PPREEAGKELCELRRSPSIHGRHQHTPRTWSLEEPSLPALRAPSPPRSLFGGPTDDYVR
FT                   PRTPLDTIAEQEPRDGQGATMARRGTPRLEMKPEHVLPRPQTPVRKFTDNAFDREAWPK
FT                   ENKKGEGFKPEILKTPEQGMPILKPSTSSGKLRRTNRSISGDLRAASRALDSQPSNLDL
FT                   DQLPSSSSYDPVTDKGKRPLRNMSDVYVSH"
     atggtgcttc ttcatggctt ccagcatccg cggttagcgc agctgttgtt gcagaggcct        60
     cggagccaat ccacctcacc cccagccaca gagaagacac tcgacctgac cccgaagtct       120
     ctgagccgcc ccgcttcacc tgaaacaagc cacccgcagg ggtcccgatc ccccaagcaa       180
     cgccgacact ccgtggccaa gtccaccact gaatcaccca cagctgtgcc tctccacttc       240
     cgccggcccc caacttcccc aggcctttcg cgcgcagtcc ctgttgaaca acccgcccct       300
     atcgcctccc caggctcgcc aagccagcaa cgcaaccgcc ggcccgggtc agtcgagttc       360
     cgaaactcgc gtgaaatccg ccctctatgg ctcgtcgagc gtcacagttt gaccaagggc       420
     gagcccgaga ccgaggagcc cctgccatcg ctcccatcca gcaagacatc ctcccgggtc       480
     ccgtcaatag aggatctgaa atccctccgt gacgacgacg gtctcaagag ctgggagcat       540
     gtggatctga gtcactcaat cacgggaaac cagcggccaa ccggtctgac catttcaact       600
     gagcaagcga acgaaagcca tagtggagac gttgatctcc tcggctcgca gcaggccacg       660
     cctaccgctg aacacttcca ggatgccgag tccaggaagg agaggccaag atacgaattc       720
     cactctccct ctgagcttct gcgggacccc accgctctgg acgagctgcc tccttcacct       780
     acgctggacg ccctgccttc tgcagagggc tctcttgttg gcgtcggctc tagggagcaa       840
     gaaacccagc gtgcgcttga cgctcttgag ggcgtgtccc gccctcagtc tgagtcggaa       900
     accccaaccc aagacaacaa ttcgttgtcc agcgccgctg cggaatttgc caagggcgct       960
     ggcttcgccg gtgttgtcga tgccgttgcc attgccgctg ccagggagca tgatcagtct      1020
     cgcgccttgc ctggagatga actcgccaag ccccgtagtt tcggcgatat tgtcgatgca      1080
     gcggttgccg ctgacggttc ctcccacgac catgacaagg cacctgtcca cgaggaggcg      1140
     ctcagtgagc ccgttactgc tattgaggag actgctcctg ctccgcttga gcctgtccac      1200
     ccagagatgg agacagccaa ggaatctgtg cctgaatcga ctgaacaacc tgttcagtct      1260
     tcagatcgtc aagctcagcc cgagacagaa gtcgctcccg acgagagcgc ccagtcttct      1320
     aaaaagaaga acaaaaagaa gaagggcaag aagaaccagg cccaagatgt agaactggga      1380
     ggtcccgagg aacccctcgc gcaggaagaa ctgtccaagg agccggtgga ggagcctgct      1440
     atggacacgc ctacggtcga aactgtttct gctgagcccg aggtttctgt ccccgagcaa      1500
     tccgagccgg ttgaggcatc ccgtgagctt ggacctggga ctggggctga tgagcctgtg      1560
     gtcgaaggtg cccctgttga gtcagcgcct gtcgagagcg ctccgattga gcccgaggtt      1620
     gccaatcccg agcaacttga ggctgagcct atcgaggctt cccgtgaggt tgagattgaa      1680
     ccttcggttg aagccgctca agaaccggga gttgttaccg cccccgaggc cgagtctact      1740
     gaggtgccgc ctgctgaaac cgaactggcc gaggacgctg catcttcgac taaaaaggct      1800
     aagcgcgaca agaaaaagca gaagaagaaa tctaagaacg aatcgacttc cgaagagcct      1860
     acagatgata atgtggttgc ccagcctcag gatgatactt ctgcctccaa ggagattgaa      1920
     ggccaacaag aagacagcgc acatgcgcct tccgaagaga ttgtggctac gcccttgccg      1980
     gaggaaatgg ttacttctac tgaatctacc gagagcaccc ctgaccagac tgccacctca      2040
     tctgctgcca ttgatgcaga gcaagctcga agtcatcctg aatctggaga gctggttgag      2100
     cctgtcgaac aggtatctac cgaagagcca gttttacctg tctccgaagg tcccagcgtg      2160
     cccattgagc tgaccccgga acctgctttc actgatgcca atgaaacacc aattaccagt      2220
     gctactcaac cggaagcgga ggaagtatcc cgcagcctgg aacagattga gaagccaagt      2280
     gaagagtcta cgccagaggc ccctcttgat aacaccacgc ctgaaattac tgaaacaccc      2340
     aaagaagaca ccgaaggcga agacaacttc gaagaggctg tcgaggaaca gattccacag      2400
     cctgccgaag aaaaggagcc tcccgtcgag gaacctcccg tcgaagtggc tacagatgcc      2460
     cccgcagagg cttcggaaac taaggcggag aagcggaaaa acaagaaaaa gaagaatcgc      2520
     aagtccactg ccgtcgaaga aactgatatt tccactgaaa tgcccgctcc cgagactgaa      2580
     ttgcctccag aaagaaaaga gcccgaacct gagcagtcag ctgttgtcga acctgcggat      2640
     acccaatccc ttccaattgg cggtgaagcc ttaccttctg atcctgaaca tcttgaacag      2700
     cctaccaagg atgttgatca gcccatcgaa actaccattg aggagtctgc agctacccag      2760
     gagcaggagc aagctccatt ggaggccgct gtggatgcaa cacctgctgt gaccgaacca      2820
     gtggatcccg cggggccatc tgatgaactg tcgcagccag ctgtcgtcga ggtccagcct      2880
     gatgctaaac tccctgctga ggaggcttct cgcgaaatcc cagagccttc tgccgttgag      2940
     actcaacctg aagccgaagt tcaagccgaa cctcaacctg aagttgcagc cgagcctgaa      3000
     gtcgccttga ctgcggctca gaagaagaag gctaagaaga ataagaagaa gggcaagcag      3060
     agtgattctt ctattcctga cgagaagcct gctgagtcta cctcgccggc acctgaagct      3120
     gagactgccg ctgaggagat agccaaggaa acccttcttg ccaccgaaga cacaccggtg      3180
     gttgcacctc ctcaagaaag cgagatggag gtgcccgtca aggttgaaca atcgattgag      3240
     cccgagcaac tccctgagac tgagcaaatt cctgaggatt tgccggccct ggatgaagct      3300
     tcccctgagc ctcttccgga accaatggca gaggtaacag agacacagac aaccaaagaa      3360
     gagtccaacg caccagggga ggagcccaaa gccgaagagt ctcccgctga gccagaggtc      3420
     cctatgaccg ccgcggagag gaagagggcc aagaaggcga aaaagaagca gcaaaaggag      3480
     caggaagaga gcattggctc tattgctgaa gataccaagc ccgtcgagac cgtgcctgcg      3540
     cccgatgctg aatccgctga gccaagcaag gatattgcgc ccgcagcgga aattgataat      3600
     gttgctccag cggactcgtc tgcgcctgtg tcttccgagc ctgctgagac tgaacaggat      3660
     gttgcgccaa catctacaac cgagccggag gcagctccag tcaccgaaga tactcctctg      3720
     ccaaccgatc ctgaatctat cgagcccacg aaaggcatcg aggctcccgc taaggctgag      3780
     ccaccggtaa aagacgctgc cccatcgcca gagattgggg caaccgaagt tgctgccgat      3840
     gttccacttg tatcggaaga agcggccgct cctgtcgatg tgccccaaga ccttgaccaa      3900
     cataacgatg tcgtcaaggc agaggagccg aagagcgagg atctgactcc agcgcccacg      3960
     caagaggcct cggctgatgc tccagagacc gatgccccta aagcacaaga acaatctccc      4020
     gaacccgagg ttctaatgac tgctgccgag aggaagaagg ccaagaaaaa caagaaaaag      4080
     cagcagaaac aagaggctgt gcagcttgac gagcagccca cgcgtgaggc tgagcctact      4140
     tctgctgagg aaaagagtgt cgaacaatcc ggtgacatgt tgcctgagag tgagcccaca      4200
     cctactgcag aaactgccgc aggtgttgat gaccccacgg aacctgaggc agccagcgac      4260
     ctcgaagccg agaccaagcc tgaagaggaa caacttcagg atgtggcaaa actcgactcc      4320
     gaagttgttc ccggggctcc ggcagacgag gctatttcta cccccgagac tgctgaacaa      4380
     gctattgatg ttcaagatgg gaacaaagaa accgccccag agcctacagt tgaagttcct      4440
     gcttccacgg aagaccccca ggaagcacag aagcttgatt cagccatcag cgaggagctt      4500
     gctttagaga agtctctcga tgacaagccc acagagtcta catcagagcc agttgcagag      4560
     gagacccagc ccacggagtc agcaagtcca gtcgtggagc aggttgaaga tgaacaggcg      4620
     gcaacttctt ctaagtcgaa gaagaagaat aagaagaaga agcgccaatc agttgccgct      4680
     gatgaagagc agcctgcacc cgccgaggaa gaggtcaagc ctgcacctac cgaagaggag      4740
     cctacacctg tgcctgctga aaacgaaccc actgagccgg caccatctca agagcttgaa      4800
     cagccttctt ccggcaaaga tgcggatact cctatggtga cggaagaggc acctaaggcc      4860
     ggagagcccg tcatggacga gaccacacag ccagaggccc ctgccgatac agccgccact      4920
     gaggctgctg cagaggcagc aatgactcct gctcagaagc ggaaggccaa gaaagacaag      4980
     aaaaagcgcc aatcagttgc tgttcaagag gagcagcctg ctgccgctga ggaggaatct      5040
     aaggctgccc ctgttgggga agaggtcaag gctgcacccg aagaggagcc tacacccgtg      5100
     cctgcggaaa ataaacatac tgaatcctcc tctcaagatc ttgaacaacc ctctccagaa      5160
     aaagacgctg agacccctat tgtgatggaa gaggcgccca aggctgaaga gaccacgcag      5220
     ccagaggccc ctgccgatgc cgctgccacc gaaaccgttg aggaggcagc aatgactcct      5280
     gctcagaaga agaaggccaa gaaagacaag aaaaagcgtc aatcagtaat tgctgaacag      5340
     gaacagcctg cctctgttga tgagcccaag cctgaactag ccgaggaaaa ggccacgcct      5400
     acaccagccg aagaggatcc cacgcctgag tccggtcagg aagagcttgt tgagcctaca      5460
     ccgactcagg aaattgaaca gtccgctgtc gaaaaagacg tggagtctcc tattatgaca      5520
     gaagaggcgc ctaaggccga agagatcatg cagccagagg cccctgccaa tgcagctgcc      5580
     accgaagccc ttgaagaggc agcaatgact cctgctcaaa agaagaaggc caagaaagac      5640
     aagaaaaagc gccaatcagt aattgctgaa gaggaacagc ctgcctctgt tgatgagccc      5700
     aagcctgaat ccgcccagga agagcccgct aaggctgagt cgacccggga caccgagcat      5760
     tcaactgtcg acaaagatgc gcaggctcct gttatggcag aagaagcgcc taaggcggaa      5820
     gaaccgtctc cagaagaggc cacgcagcca gagggccctg ccgatgcagc tgctaccgag      5880
     gccgctgtcg agactcctgc ggaggaggca atgactcctg cccagaaaag gaaggccaag      5940
     aaagacaaga aaaagcgcca atcggtgatc actgaagagg aacagcctac gcctgttgag      6000
     gagccaacgc ccgaatccgt tcaggaaaag cccactgagc ctgagtcgac gcaggaaatc      6060
     gaacagccca ctcttgacga ggctgcgcag actcctatta taacagaaga agaagcgcct      6120
     aaggtcgaag aaccttctct cgaaaatgtc acgccacagg atgctcctgc tgatgcagct      6180
     gctaccgagc ccgctacgga ggagacaatg accccagctc agaaaaagaa ggctaagaag      6240
     gacaagaaaa agcaacaaaa atctgttgct ttcgacgaga atgccactct gactgaagac      6300
     cccaagccag agcaggatac atctacacct gaagagaagg ttgaatctcg ggatgctccg      6360
     gctgacttga ttgtctcgga agaatcagcc aaggagttgc cagtgaccga agaagccgcc      6420
     gagcctgcgc ctgaagcgga catctcggag acgagggaag agcccgcttc ctcggaagaa      6480
     agcaaggaca ccactgagca tgagccaacc tcaactactg cgcccgacac cccagttcct      6540
     agcgaagtca aggagccaga gtccgcagcg gcgttaccag agcacccgga acaagatgcc      6600
     cagactcccc cggagttcca gaacccgagt gcacaagagc ccgaagttgc cttgactgcg      6660
     gcgcagagga agaaggcgaa gaaaaacaag aagaagggca agtctgtgga cttagccgac      6720
     aacgcccctt ctgccacaga cgcagtgcag gaatctgagc ctaaatctga gcctgttgtt      6780
     caaacttcca cagatactcc agctgagacc ccggagttgc aagatactcc agcctctgag      6840
     ctagcgctgc ccgcagaagg tctcgagcaa gacaatacca tcgagcccga ggcccccaag      6900
     gccgaggagc acgagacaac ggaagccgta tccgacgatg tgacgaaaga ggaaacccct      6960
     gaagccaaga agaccgacaa cgaacccccg gcgactgaaa caattctcga tgctgagcca      7020
     gctccctccc aggaagtaga ggcagttgcc tcttctccta ccgaaccgac cgaagaagcc      7080
     ggcatgtcag ccaaggagcg acgcaaagct gccaagaaag cgaagaagcg ccagtctaag      7140
     aatgtcgacg ccgataccga cgccgcaaca tccgatccgc cttctgcccc agcaaccgag      7200
     cctaccgcac ccattgaagc ggccgacagc gttgaaaaag tcctgacctc tacggacaca      7260
     gacgcccctg gactctcagc cgtaccggcg tcctcgcctg cggaacatga cggtaaagaa      7320
     catcagtccc acggcataga aacttacgac gccacggcgc aagatacgac ctcgactgat      7380
     aaagacatgt cttcgcaggt agagcagacg ccgatagaga gtcctttttt agattatcct      7440
     ccccagcccg tgcttgagcg cgatctctcc acggagaagg agattgaaga gatgcctgtg      7500
     gatgtgccaa ttgatgttgt tcctgaggca cagatacagg aatcccctgt ggaggaaaaa      7560
     gcttctgagg cagctgtctc gaagaagcac aaaaagaaaa acaaaaacaa aaacaaggat      7620
     ataaagcaag aggaggaagc tgcagtacct gagcctgcga gctctactgc agaggacaag      7680
     gagcagtcgg aagctgggcc ttcggttgag gccgagatcc agccagaggt aaaggaaatc      7740
     attgagcctg agcccattgc cgtggccgaa tcagtgccaa ttccagagga gcaacaacca      7800
     gatcaactgc aggacattga agagactgcc gctgtccaga caactgagga cgttgatgat      7860
     accaaggaga tcaatgtccc agaagccgag gccgctgctc ctcctaccga agacaccacg      7920
     cagccagagg cccctgtcga tgtagctgac atcgaggcca ctgaagatgc atcaatgacc      7980
     cctgctcaga agcggaaggc caagaaggac aagaagaagc aacgacaatc aattattgct      8040
     caagaacccg aagcagaggc ccagcctgag gaaaagacag cacccgaggc ggctgaaact      8100
     tctgcccaag aggctgggat tacaacagag gcagcgcctg gcgaaattgt cacgcaagat      8160
     gaggctgttc ctagcgcaga ggagcccaca gcgcagccta tcgatgccat ccaggaggcc      8220
     gccaaggacc ctgtaacgcc ctctgaagac actgagcagc atgttctaag ccaagaaatt      8280
     gagaatggag agcgttctct cgagcttcct tccactgaat ccaaagtcga ggaaggagac      8340
     aaaccgaccg agcaagctgc cgcagccccg gcggagaacc cagatgacga gcaatctagc      8400
     aaaaaagggt tgcctgaagc cggccccgag cctgaagggg aatcggcgac tgtccccaag      8460
     aagatgagca agaaagagaa gaagaaggcc gccgccgctg ccgccgccgc cgcccttgtc      8520
     aaggaagaaa agctcgctga gtcacaacct gaacccaagg aggccttggt cagcactcca      8580
     caagctccag aggaagtcgt agaccagtct atggttcaag agccgcaatc ctcagagact      8640
     gaagacaagc ctccgcctga agccgaaaag aacccggatg aaattacagg tttgcccgct      8700
     tctaggctga aagaagatgt tctagagcag cctgctgagg ctctcgattc taccgagccc      8760
     ctcgaatctg aggtcaaact ggaggagtct acaaaagagc tagccgaaga gccagctgcc      8820
     gctgaaacta ttactcggaa aatgtcaaag aaggacaaga aaagagccaa aaagcaagcc      8880
     caagaagaaa taattgagcc gacttcgcct ccgaccgagg atcatgctca aagcgagaaa      8940
     aatgaagcag tcatttctct tggtacactc gatacgccct cgcccgtgga acccactgac      9000
     cagaatacca acaatgagcc ccttgacctc gagcgtcctg cagagaagaa cgataagaaa      9060
     gatgaagctc ttgttgtggc cgattcgcag aaccttgaga acgcagctgt ggatcaacca      9120
     gtacaacctg aagtgatgcc ggccatgtcc aagaagatgt cgaagaagga caagcgcaag      9180
     gtcaagaaga atgccggcat caccgaagaa gtcttggctc aacaacaaga gcctcaggct      9240
     gatgtggctg agttgcccac agaatcagag gtccagccgg cagagcctgc ggcggagaaa      9300
     gagatccacc aggaacctga acattctgca gaagctcaac cttcattgga gcgagagttg      9360
     ccgattgaga ctcccgcttc aattgagaat gagcctatac cagacccagg agttcaggtt      9420
     aagccaacgc aacccgatga agagcccgtc gtcagcgagg aggttcctct ctcacgcaag      9480
     gcctcgaaga agaaggccaa gaaagcccaa aaggccaaca aatccctgga tgctgaggca      9540
     ctggctgaaa acacgatcgc ggatcaccac actaccattg tgccgtttga agaggaccaa      9600
     tccaaggcag agggcctgga agtgccagac gaaaagtccg cccaagacga agaagactgg      9660
     cccgcaattg actggcaggc caagtttgaa gagtcccagc gatcaaggga agcggaccct      9720
     gaacctgagc cggacattcc agctcccgag ccggagatta ttggagaatt tgttgattca      9780
     tcattccgcg aagtttcgca agatgcaaac gaagctacgg aggaagatgc ttgggccttg      9840
     ccaacgagca aaaaagacaa gaagaaggcc aagaagaaca agaagcagtc acagcaaact      9900
     cccccggaag ccgagggacc ttcactggaa cccttcaacg acatagagat cgagccacct      9960
     gcccggacaa ctactcccgg tggatctaag attgccaact tatttcccgg cctcgagcgt     10020
     gggggattcc ggcgatcagc tttggaccag caaccacggt cgctaaaaga tagtgctgag     10080
     gaagagacaa cagcggactt ggaagcgaat cgcgatgtcg cgatccctgt cttggaagca     10140
     cccccagcga ccactgaaac caaagaaatt ccccgcgatt ttacctcgga gctgcctagc     10200
     agcctcgaaa gacaaattga atctacaatc tcggagctga aagctcactc cgaaactcct     10260
     actgctacgg agcatggatc aatcagggag ccagaacttc cgccggaggg cgacaagtcc     10320
     aaggatatgc catcgtcatt gtcaatggaa ccctctgatg agcggactcg tcccactgaa     10380
     ccttcttctc ctacgcgcct tccgccccgg gaagaagctg gaaaggaact gtgtgaatta     10440
     cgccgatcac catcaatcca tggacggcac cagcacacac ccagaacctg gagcttggaa     10500
     gaaccctctc taccagctct gcgtgccccg tcccctcctc gctcgctctt cggaggaccg     10560
     accgacgatt atgtgcgacc ccggactccg cttgatacaa ttgcggaaca agaaccacgg     10620
     gatggccaag gagcaaccat ggctcgtcgc gggacgcccc gtctggagat gaagcccgag     10680
     catgtcttac ctcgacctca gacacctgtc cggaaattta cagacaatgc ctttgatcga     10740
     gaagcttggc ctaaagagaa caaaaaaggc gaggggttca aacccgaaat tttaaaaacg     10800
     cctgagcaag ggatgccaat tctgaagccc agcaccagca gcggaaaatt acgtcgtaca     10860
     aatcgcagta ttagcggcga tctgcgggcg gctagtcgag cgctagattc ccagccttcg     10920
     aatctcgatc tcgatcagct cccgtcttcc tcctcttacg accccgtcac cgacaagggc     10980
     aaacgtccgt tgcgaaatat gtcggatgtc tatgtaagtc attaa                     11025
//

If you have problems or comments...

PBIL Back to PBIL home page