(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE48

PENCW_10.PE48        Location/Qualifiers
FT   CDS_pept        join(complement(113839..114623),complement(113532..113784))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977823"
FT                   /orf_name="Pc13g00480"
FT                   /product="Putative uncharacterized protein Pc13g00480 "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91117.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001830E96"
FT                   /db_xref="UniProtKB/TrEMBL:B6H186"
FT                   /transl_table=1
FT                   /translation="MSDPQWLWDPLSICEMGPIRETKTCCGITKKGDACKLIVKKDTLK
FT                   EGRHKLNNLARGPFNLSTLDSQLSDLVSFFLCKQWHRERQHNDVKQRWFDAAVRNQADV
FT                   QESPRQRFPHIIAEEIDGPQQEPASTALETDGFAPIWGVDAAFPRLPSPTWLEVTRPPG
FT                   RDVTPGMLTMNRVPWNVSRDNPAILSIHNEYGGLHSLQIHTVRQESCPDGERCPICFEG
FT                   DSDDLVMLQCGICKGVVHLGCMEGWLAHRLPGNNTSCPIHRCNGSFRALLRSSAVGNAT
FT                   GNSTAETPLEDTYTPVEETSVPTAPPQRRSTQTTRRSDRPRVFSSSSIIRRSPRSRRVP
FT                   DRFLP"
     atgtcagacc cccaatggct ttgggatccc ttgagtatct gtgaaatggg gcccattagg        60
     gaaactaaga cctgttgtgg cattaccaag aaaggagatg cttgcaagct gatagtgaag       120
     aaagacaccc tcaaggaagg tcgtcacaag ttgaacaacc tagcacgagg cccattcaat       180
     ctttctactc ttgactccca gctcagcgac cttgtatcat tctttctctg caaacagtgg       240
     catcgagagc gtcagcacaa tgatgttaag cagcggtggt tcgatgcagc cgtgcgtaat       300
     caggccgatg tacaagaatc tccacgccag cgttttccac atattatcgc ggaagaaatc       360
     gacggaccgc aacaggaacc agccagcact gccttggaga cagatgggtt tgctcccata       420
     tggggtgttg acgcggcttt cccaaggctt ccttccccga catggctaga ggtgactcgg       480
     cctcctggtc gggatgttac accgggcatg ctcacaatga atcgcgtgcc ctggaatgtt       540
     tcacgggata acccagccat tctgtccatc cacaatgaat acggtggact gcactccctc       600
     cagattcaca ccgttcgcca agagtcctgt ccagatggtg agaggtgccc aatttgcttc       660
     gagggagata gcgacgatct ggtcatgttg caatgcggta tatgtaaggg ggtggttcat       720
     ttggggtgca tggagggctg gctcgcccat cgtttaccgg gaaacaacac ctcttgccca       780
     atacatcgat gtaatggatc gttccgcgct ctcttacgct cgtcggctgt tggaaatgct       840
     accggcaact cgacagcaga aacacctctc gaagacacat acacaccagt agaagagaca       900
     agtgtgccaa cagcacctcc gcagcgtcgg tcaacccaga ctacccggcg ttcagaccgt       960
     cctcgagtct tctcaagctc atccattatc cgtcgatcac ctcggtcgag gcgggttccc      1020
     gaccgcttcc taccctag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page