(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE480

PENCW_10.PE480       Location/Qualifiers
FT   CDS_pept        join(complement(1159296..1163983),
FT                   complement(1158083..1158734))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951949"
FT                   /orf_name="Pc13g04800"
FT                   /product="Pc13g04800 protein"
FT                   /protein_id="CAP91549.1"
FT                   /db_xref="UniParc:UPI0001830DDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C9"
FT                   /transl_table=1
FT                   /translation="MFKALMGGGRSSSSDVRSSKSSRRKSEKHDKSDTRSISSRKFSRG
FT                   DDRDRGLGDLSSYPPSTSRSKRGPPSIAGESIASTYVTAEPEAIDESDRYYIERTPKRR
FT                   DSERESKSSRRHDQDRSESPEREKRRSRRGTQDTLDDDLDRESDRRERRRTHSGDPYVP
FT                   PISTNMPPSAPGAQFAAEIGAPGFSQFPMQYDAGMPPAGHSPAHEVPYDPHVQQQFPGQ
FT                   FPEQVAAPYPPPNPAGAAADYYGDQGQSVEHQPGIRPARPSVLPNTQAHLMAASPSANP
FT                   PPEPSSLGETGAAAAYFDDNFHAPAPQDQPPEVRPPKPSKPSKPSSSGVLPAAAVGAAA
FT                   HGIGGMVSHSESHSPPQHTTSYTQQGQPTVHDQPMVHHEPMEYDQPMASSSHKPPSKPP
FT                   HSHSFSEGVGIAAAGAATGYMMGHHHHSSSPEHAPQYAFEHHGQSSQVGGMLPYAPVHN
FT                   NALYAAGAGGYAAHAAHNPGFYPHGPSALAFQERQRGAMERFVDFWRDPEAVGRFEDYT
FT                   ETIGVCKYCFQPGTSSADAPRKHHYYRRRRHSPDRRSSGSSRVSKTSRYNSSDDEGRRR
FT                   SKSKKSSSWLPGVLAGYTAKSLFSSKAFDDSYSLRSGRVASHHGEEDDRRSRTSRGVAR
FT                   RSSRSPHRDYHTGSTHASQSGYSRHSRSRSRSSSRSGRPSCLKEAALGAAVGGAALAVA
FT                   KSRNPSRSRSPERRQYRKDSSSSSSFVNLPRPGKKSIAGGIGSFFTASSENKKKRHTKK
FT                   RSGFFSFKSGSSSSSLDNDLAFGDGFSRKPSKLKKKGKKGKDVDTALLELSDTATRLAG
FT                   SSPHGPGRSAGQMYKARSRQSNYSTTNDEWVDAESEDQSSSSVSSALAFGGSSVDSSSD
FT                   SASSKWGWRWGSKKDKKKKDKRSSATNAALVAGAGAIGAAAISSARDHDNNPPSRSGSL
FT                   QHVYPMPTSDPSRFDVAKMSPSVSAGEPTLIRPGPIPLQQPQPFTPVSQSVYTTQGAVP
FT                   GSIPVYSAPAVPPLFANGVEHFESQFQGPRGAAWAPESTYAERRKAPRRSDSSPVFPTQ
FT                   ETASSLKRRYTSKDQASVQFDLTEEQAERERHLTRRDKNYRGEFSDQPVQLIDREEELA
FT                   RHETERREHRRKERDDEEHRYAGDRGKHSSSWVGVAAAGAVGTAAASTILSRKTDDDEA
FT                   SEASQRYNERREKRRAERKRTEAVAVTSVVSRFEPTQPIDEEVTTAEHHEDQKKGSPRS
FT                   PRPPQVYDDYAEFYAPEELRHSPDDHARSRRSTDMPTIVEVEPASERRTHEEPAPTEVD
FT                   YSYEPYQHVDRLPWPVPALNFIEPTPPQSVNGGSVRDATSPTAPVNKSYDTKPRERPTG
FT                   SRVSWGEHETHEYEIPSSSEQDPFEHDISPAEISAKDVPLPASEITQSKDIPSTSQYGA
FT                   DIEFAATIAAATAAAGFDPSLITDDPSYHTRTSPPGSEGEHTFTSPWSASARNEPRGFV
FT                   EGELEEIDPKSTKDITSAPEHVSQDKDELFFDEPESFSRDRDISSGRRDKSSIAHEVIE
FT                   QLNGKYGKRDRTASPEKDVDVFSMPGGFDTAEPRDLADARSVAGYDFDPRLDAEAAPDD
FT                   VEGGEEKKRRRKRRSKHESDTFSVDDDARSAITDIGDEKSERRKHRHRSSRETDVDDNA
FT                   SITSSPARIDESREKRRGKDEKEKSGGFLRGIFGSQVSAPAERVRSDHSRSSSLDKRSS
FT                   REAISEIGVDDERRRHKRRSSKHRSSSNGDELDRYMSDKEKGTQDDTNLEEYRSSRQQK
FT                   EERRRHRYEEIVDSGRNRESEKV"
     atgttcaaag ccctgatggg cgggggccgc tcgtcctcat ccgatgttcg cagttctaag        60
     agcagccggc gcaagtcgga aaagcacgat aagtccgata caagatcgat ctcaagccgc       120
     aaattctcac ggggtgacga ccgtgaccgt ggcctgggcg atttgtcgtc ttatccgccg       180
     tcaacttccc gcagtaaacg tggcccacct agcattgccg gcgaatccat cgcatcaacc       240
     tatgtaaccg ccgagccaga agcgattgat gaatccgacc gctactacat tgaacgcaca       300
     ccaaaacgca gagacagtga acgggaaagc aagagttccc gtcggcacga ccaggaccga       360
     tccgaaagtc cagagcgcga gaagagaagg agccgccgag gtacacaaga tactctggac       420
     gatgacttgg atcgggagag cgaccgtcgc gagcgtcgtc gcacccactc gggggatccg       480
     tatgtgcccc caatctccac aaatatgccg cctagcgccc ccggcgcgca gtttgccgcc       540
     gagattggcg ccccgggatt ctcgcaattc cccatgcaat acgacgctgg gatgccaccc       600
     gcaggccatt cgccagcgca tgaagttcca tatgacccgc acgtgcagca acaattcccc       660
     ggccagttcc cagagcaagt tgctgcaccg tacccgccgc ccaaccccgc cggcgctgcg       720
     gcagactact atggtgacca aggccagtct gttgagcacc agcccggtat ccgaccggct       780
     cgcccaagtg tgcttcctaa tactcaagca cacttgatgg cagcatctcc atcagctaac       840
     ccaccaccag agcctagtag ccttggtgaa actggtgcgg cggcggccta tttcgacgat       900
     aatttccatg ccccggcacc gcaagaccag ccgccggaag tcagaccgcc gaaaccgtct       960
     aagccttcta agccttcttc atcgggcgtt cttcctgctg ctgctgttgg agctgccgct      1020
     catggaattg gtggtatggt gtctcactcg gagtcgcatt cccctccaca gcacactact      1080
     tcgtacaccc agcagggaca gccaacggta cacgaccagc caatggtaca tcacgagccg      1140
     atggaatacg atcagccaat ggcaagcagc agccacaagc ctccatccaa gccaccccat      1200
     tctcatagct tcagtgaagg tgtcggtatt gcggctgcag gtgctgcaac ggggtacatg      1260
     atgggtcatc atcatcactc ctctagcccc gagcacgcac cacaatacgc ctttgagcac      1320
     cacgggcaat cttctcaagt tggtggtatg ctaccgtatg cccctgtcca taacaatgct      1380
     ttgtatgctg caggtgcggg aggatacgct gctcatgctg cccacaaccc gggtttctat      1440
     cctcatggac cgagtgccct agctttccaa gagcgtcagc gtggtgccat ggaaagattt      1500
     gttgatttct ggcgtgaccc tgaagccgtt ggaagattcg aggactacac ggaaactatc      1560
     ggtgtgtgca aatactgttt ccaacctggc acgagctccg ccgatgcccc tcgaaagcac      1620
     cattattaca ggcgccgccg acactcgccc gatcggcgga gcagtggtag ctccagagtc      1680
     agcaaaacca gccgatacaa ctcctccgat gatgagggcc gccgacggtc aaagtccaag      1740
     aaatcttcct cgtggctgcc tggcgtgcta gctggttata cggccaagtc actcttctcg      1800
     agtaaggcgt ttgacgattc ttacagcctt cgctccgggc gagtggcctc ccaccacgga      1860
     gaagaagatg accgaaggag ccgcacctct cgtggcgtgg cccgtcgttc tagccgcagt      1920
     cctcacagag actaccatac aggctccacg catgcctctc aatctggata ttctcggcac      1980
     tcgcgctctc gatcgcggtc ttcctcccga tctggccggc cttcgtgcct gaaggaagcc      2040
     gcactcggtg ccgcagtggg cggggctgca ctggctgttg cgaagtcccg taacccctcc      2100
     cgtagtcgtt ctcctgaaag acgacaatac cgaaaggatt catcttcgtc atcgtccttt      2160
     gtcaatcttc caaggcctgg caagaagtcc atcgctggtg gtatcgggtc tttcttcact      2220
     gcttcttccg agaacaagaa gaaacgtcat accaagaagc ggagcggttt cttctctttc      2280
     aagagtggct cttcatcctc ttcattggac aatgatcttg cattcggaga tgggttttcg      2340
     aggaagccct ccaagctcaa gaagaagggc aagaagggta aagatgtcga caccgctttg      2400
     ctagagctta gcgacacggc aacccgtttg gctgggtcct caccccacgg tcccgggcgc      2460
     agcgcaggcc agatgtacaa agctcgatct cgacagtcca actactctac gacaaatgac      2520
     gaatgggttg atgccgagtc ggaggaccag tcttcttcaa gtgttagctc tgccctggca      2580
     ttcggaggaa gcagtgttga ctcctcctcc gactccgcta gcagcaaatg gggctggaga      2640
     tggggaagca agaaggataa gaagaagaag gacaagcgtt cgagtgctac aaatgccgct      2700
     ctggtagctg gcgctggtgc tattggagcc gctgcaattt cttctgctcg tgaccatgat      2760
     aacaaccccc caagcagatc tgggagcctg caacatgttt acccaatgcc tacttccgac      2820
     ccgtctcgct ttgatgttgc aaagatgtcc ccgtctgtat ctgccggtga accaacgctc      2880
     atccgcccgg gacccattcc ccttcaacag cctcagcctt tcaccccagt ctctcaatct      2940
     gtgtatacta cccagggagc tgttccggga tcgataccag tgtacagcgc cccagcagtc      3000
     ccacccctct ttgccaatgg agttgaacac ttcgaatcgc agttccaagg ccctcgtggt      3060
     gcagcatggg cgccagaatc aacgtacgcc gagcgccgga aagctcctcg acgtagtgat      3120
     tcctcccctg ttttccccac tcaggaaact gcttccagtc tcaagcgccg atacacctcc      3180
     aaagaccaag cctccgtgca attcgacttg acggaagagc aagcagaaag ggaacgccac      3240
     cttactcgtc gtgacaagaa ctaccggggc gaattttctg atcaaccagt tcaactgatt      3300
     gaccgagaag aagagctggc ccgccacgaa actgagcgcc gagagcaccg tagaaaggag      3360
     cgcgatgatg aggagcaccg gtatgccggc gacagaggaa agcactcctc atcctgggtt      3420
     ggtgtagcag cagctggagc tgttggcact gctgctgcca gcactattct ctctcgcaag      3480
     acagacgatg acgaagcctc tgaagccagc cagcgataca atgagcgccg agagaaacgc      3540
     cgggccgagc gaaagcgcac cgaagcagtg gcggttactt cggttgtctc acggttcgag      3600
     cccactcagc ctattgatga agaagtgaca acggccgaac accacgaaga ccagaagaaa      3660
     ggatcacctc gatctccccg tcccccacaa gtttacgatg attacgcaga attttatgcc      3720
     cctgaggagc tacgacacag cccagatgac catgctcgca gccgccgctc cactgatatg      3780
     ccaaccattg tggaggtaga gcccgctagc gaacgacgta cacatgagga gcctgcacct      3840
     acggaggtgg actattccta tgaaccatat caacacgtgg accgtctccc gtggccagtc      3900
     cctgcgctca acttcattga gcccactcct cctcagagcg tgaacggtgg ttctgttcgc      3960
     gacgctacct ccccaaccgc ccctgtaaat aaatcttatg ataccaagcc ccgggaacga      4020
     ccaaccggct cccgtgtctc ctggggcgag catgaaactc atgaatacga gatcccctct      4080
     tcttctgaac aggatccctt tgagcatgac atttcccctg ccgaaatttc agccaaggat      4140
     gttcctctcc cggcgtccga gataacacaa tccaaggata tccccagcac atcgcagtat      4200
     ggtgccgata ttgaattcgc ggccacaatt gctgctgcga ccgccgcagc tgggttcgat      4260
     ccctccttga ttacagacga cccatcctat cacacccgca cttcccctcc tgggtcggag      4320
     ggtgaacaca catttacctc accctggtct gcatcggctc ggaatgagcc ccgcggcttc      4380
     gtcgagggcg agctcgaaga aattgacccc aagtctacta aggatattac ttccgctcct      4440
     gagcacgtat cccaagacaa agatgagctt ttcttcgacg agccggaatc cttctcaaga      4500
     gatcgggata tttcttcggg ccgccgtgac aagtcctcga ttgcccatga ggttatcgag      4560
     cagctgaatg gcaaatatgg caagcgcgac cgtaccgctt cccccgagaa agacgtagac      4620
     gtgttctcga tgcctggtgg ctttgataca gccgagccta gagacttggc tgatgctaga      4680
     tccgtggctg gatatgattt cgacccacgt cttgatgctg aagccgctcc tgacgacgtg      4740
     gaaggcggcg aggagaagaa gcgacgtcgc aagcgccgat ccaagcatga aagtgatact      4800
     ttctctgttg atgacgatgc ccgctccgcc attacggaca tcggagatga gaagtctgag      4860
     cgtcgcaagc atcgccaccg ctcttcccgg gaaactgacg ttgatgacaa tgcctccata      4920
     acctcttctc cagctcggat tgacgaatcc cgggagaagc gccgaggcaa ggacgagaaa      4980
     gaaaagagcg gaggcttttt gcgaggtatc tttggctcac aagtgtcggc cccagctgag      5040
     cgtgttcggt ctgaccattc tcgttcttcc tcgttggaca agcgctcatc ccgcgaagcc      5100
     atatctgaaa ttggtgtgga tgatgaacgc cgtcgccata agaggcgttc ttctaagcat      5160
     cgcagctcca gcaatggcga tgaattggac cgctacatgt cggacaagga gaaaggcact      5220
     caagatgaca caaatctgga ggagtacagg tccagtagac agcaaaagga agagcgtcgt      5280
     cgtcatcggt acgaggaaat cgtggattca ggaagaaacc gggaatctga gaaggtatag      5340
//

If you have problems or comments...

PBIL Back to PBIL home page