(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE481

PENCW_10.PE481       Location/Qualifiers
FT   CDS_pept        join(complement(1165818..1165854),
FT                   complement(1164752..1165761))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672738"
FT                   /orf_name="Pc13g04810"
FT                   /product="Pc13g04810 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91550.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001830DDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D0"
FT                   /transl_table=1
FT                   /translation="MTPNARKWPSREGFTADVLGKFISRSLLDPWKLVPIVALAQYTAQ
FT                   GRDIAKARPNLEKALKALTALALINRLGNWLDRRTLNNSTSDPYDWNREVVILTGGSNG
FT                   IGRRIAELLGARDIKVAILDIAPPATDDVLPNSVRCYECDITSATDIADVASKIRSSFG
FT                   RPSILINNAGICTGKTILKTTPAQTRRMFEVNTLAHYWLAQEFLPDMIEANHGMVVTVA
FT                   SLAGYTVTPNMVDYSATKAAAIAFHEGLAAELVTRYHAPKVRTVLVTQGFTRTNLIKDL
FT                   TPEDTWLNPLLHPETVAEELVRQVLKAESGHVVIPGSAGWIARRFRGQPEWLQHLLRCR
FT                   LEKLMRAD"
     atgacgccaa acgcaagaaa atggccctca agagaaggct ttacagctga tgtactggga        60
     aaattcatct cccggagtct cctggacccc tggaagttag ttcctattgt tgctctggcc       120
     caatacacag cccaaggccg tgatatcgcc aaagcacgtc caaatctcga aaaggccctc       180
     aaagccctaa cagccctagc cctcatcaat cggctaggca actggctcga ccgtcgcacg       240
     ctcaacaaca gcaccagcga cccatatgac tggaaccgcg aagttgtaat cctaacaggc       300
     ggcagcaacg ggatcggccg acgcatcgcc gagctgctcg gggcgcgcga tatcaaagtt       360
     gccatcctgg acatcgcccc gccagcgacg gacgacgtgc taccaaacag cgtacggtgt       420
     tacgaatgcg acataacctc cgcaaccgac atcgcagacg tagcgtccaa aatccgcagc       480
     tcattcggcc gacccagcat cctaatcaac aatgcgggca tctgcaccgg caaaacaatc       540
     ctcaaaacaa ctcccgccca gacgcgccgc atgttcgaag tcaacacgct cgcgcactac       600
     tggcttgcac aggaattcct gcccgatatg atcgaggcga accatggtat ggttgttact       660
     gttgcttcgc tggctggata taccgtcacg cctaatatgg ttgattactc ggcgaccaag       720
     gccgcggcta ttgcgttcca tgagggactt gctgctgagc tggttacgcg ttaccatgcg       780
     cctaaggttc gcactgtgct tgttacacag ggttttacta ggaccaatct tattaaggat       840
     ttgacccccg aggatacttg gcttaatccc ctgcttcatc ctgagactgt tgctgaggag       900
     ctggttaggc aggtgctcaa ggctgagagt gggcatgttg ttattcctgg atctgctgga       960
     tggattgcaa ggagattcag ggggcaacct gagtggttac agcatttgct gaggtgcagg      1020
     ttggagaagt tgatgagggc tgattag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page