(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE482

PENCW_10.PE482       Location/Qualifiers
FT   CDS_pept        join(complement(1167392..1169445),
FT                   complement(1167006..1167321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951950"
FT                   /orf_name="Pc13g04820"
FT                   /product="Pc13g04820 protein"
FT                   /protein_id="CAP91551.1"
FT                   /db_xref="UniParc:UPI0001830DDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D1"
FT                   /transl_table=1
FT                   /translation="MPRTQVSPNVFDPGSQDLGASKFGQKLPPMDPRLDQKEAEGELSI
FT                   PVEHTTAAHKLLMWPSIKRLLHPAHYDEDYVMRLEEERGLISIYGQGEISYTADDSQLP
FT                   MDGDSRGARPDVNGAGPDANVDIDEFGNLNLDAATARRYYDSYLEHMFKLHPFLMEGEL
FT                   NIKVDSFIRSYCRLNNSPPSSSSGYSRPARDGPPPAKRRRSNENLGVRGEYMETIPNPL
FT                   RPRVGKNIDNALVLLCLALGAICEAPTPLPGPIMDKKIDYLNQPIPAPLPPLTPPQPAN
FT                   TTYVTNANGVLSPANSDSAAMQMSFSNSLYSVPTQPAGQAFPNSPFTKGIEGLSRRDVT
FT                   NTRDEQGNTKNYQVIPGLTLYGYATTILGHLQGGNELEHVQCGLLAGLYAGQLAHPFQS
FT                   HSWISQASRACQVLVRTKRYERLEEGATQDLYNFAYWTCLQLESDLLAELDIPASGISR
FT                   SEGRMAIPKGKWTIVLPNDLTAPETMMMLFYSAQIHLRKLLNRVHTDLYKVEKQGQTRW
FT                   SSTVQEALSLNLDLWRNSLPHSMQWSENDPPADEINAARMRAKYYGARYIIHRPLLYHA
FT                   LHYGYTGARVGPIGKSLVDSPTSQQLSPSMMHSAGRAPSMARMSSEMGSMPAALSTDWQ
FT                   PPKVRLHELPKKLKTACDICIRSAIKSTEAFDGVGGHRLVVTNIFGTAHAQFGNMLVLS
FT                   ATYMSSLKELVDQDQLDRLLVRTIGFLIQSENISPTLRADARILTEIYKKIFGRAPDLR
FT                   RATKVSSQTPSMNSQTPSLSSQTPSLSSHTTSMSFP"
     atgcccagga cccaggtctc accaaatgtt tttgaccctg ggagccagga tttgggtgct        60
     tcgaagtttg gccagaagct tccacccatg gacccgaggc tcgaccagaa ggaggccgag       120
     ggagagctct ccatcccagt agagcacacc actgcagctc acaagctatt gatgtggccc       180
     tcgattaaga ggctgctaca cccggcacac tatgacgagg actatgtcat gcggttggaa       240
     gaagagcgcg gtctcatcag catatacggc caaggcgaga tctcgtacac tgccgatgac       300
     agtcaattac caatggacgg tgactccaga ggtgctcgac ccgacgtgaa tggcgcagga       360
     ccggacgcca acgtcgacat cgacgaattt gggaacttga atctggatgc tgcgactgct       420
     aggcgctact atgacagcta tctcgagcac atgtttaagc ttcacccatt ccttatggaa       480
     ggtgaactta atatcaaggt cgatagcttt attcgaagct attgtcgcct gaataactca       540
     ccaccaagtt catcttccgg ttacagtcga ccagctcgtg atggtccgcc gccagccaaa       600
     aggaggcggt caaatgaaaa cctgggtgtg cgtggcgagt acatggagac tatccccaac       660
     ccgctgcggc cacgagtcgg caaaaacatt gacaatgcct tggtcctgct atgcctggcc       720
     ctcggagcca tttgcgaagc tcctacccct ctccctgggc ccatcatgga caagaagatc       780
     gactacctca accagcccat tcctgctcca ctgccaccat taaccccccc gcagcctgcc       840
     aatacgacat acgttaccaa tgctaacggt gtgctttccc ccgcaaactc tgactcggcg       900
     gccatgcaga tgtcgttttc gaattctctt tatagtgtgc caacccagcc tgccggccag       960
     gctttcccaa atagtccatt caccaaaggc atagagggcc tgtcaaggag agacgtcaca      1020
     aacacgcggg atgaacaagg gaacacaaag aactatcagg tcattcctgg cttgactctt      1080
     tatggatacg caaccacaat attgggccat ctgcagggtg gcaatgagct agaacatgtt      1140
     cagtgcggct tgcttgctgg tctctatgcc ggccagctgg cccatccttt ccagagccac      1200
     agttggattt ctcaggcctc aagggcttgc caggtccttg tgagaaccaa gcgatacgag      1260
     cgactcgaag aaggggctac gcaagacttg tacaacttcg cgtactggac ctgcctgcaa      1320
     ctggagagtg atcttctcgc agagctggat attccagcga gtggcatctc ccgttccgag      1380
     ggtcggatgg ccattccgaa agggaaatgg acaatcgttc taccgaacga tctcaccgca      1440
     cccgaaacga tgatgatgct gttctattct gcccaaattc atctacgtaa actcttgaat      1500
     cgagtccaca cagacttata caaggttgaa aagcaaggcc agacccgatg gtcgtccacc      1560
     gttcaagagg ctctaagtct gaacctcgat ctctggcgca acagcctacc acacagcatg      1620
     cagtggagcg aaaatgatcc accggcagac gaaatcaacg ccgctcgcat gcgtgcgaag      1680
     tattatggtg cccgatacat tatccaccgt ccacttctct accacgcact gcactacggc      1740
     tacacaggtg cccgcgtcgg tccaatcggc aagtctttag tggactcgcc tacctcgcaa      1800
     caactgtccc cctccatgat gcacagcgcc ggtcgggctc cgagcatggc gcgtatgtcg      1860
     agtgagatgg gctctatgcc ggccgcactg tccactgact ggcagccccc taaagtccgt      1920
     ttacacgagc tgcctaagaa gctgaaaact gcctgcgaca tctgcattag atcggctatc      1980
     aagagcacag aggcttttga cggtgtaggc ggacatcgat tggtcgttac caacatcttc      2040
     ggcactgccc atgcgcaatt cggcaatatg ctcgttctat ctgcaactta tatgtcaagc      2100
     ctaaaagagc ttgtcgacca agaccaactc gaccgcctcc tcgttcgtac cataggcttc      2160
     ctcatccaaa gcgaaaatat atcccccacc ctccgcgccg atgctcgcat tctcactgag      2220
     atctacaaga agatcttcgg tcgtgcccct gatttgaggc gagctaccaa agtgagcagc      2280
     cagactccca gcatgaacag ccaaactccc agcctgagta gtcagactcc aagcctgagc      2340
     agccacacta ccagcatgag cttcccttga                                       2370
//

If you have problems or comments...

PBIL Back to PBIL home page