(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE483

PENCW_10.PE483       Location/Qualifiers
FT   CDS_pept        complement(1169856..1170416)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825425"
FT                   /orf_name="Pc13g04830"
FT                   /product="Pc13g04830 protein"
FT                   /protein_id="CAP91552.1"
FT                   /db_xref="UniParc:UPI0001830DDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D2"
FT                   /transl_table=1
FT                   /translation="MNRMPPPEAHHTHAGPHTAYDPSWRPPYPPAFDNHPSDSRRSSAN
FT                   SQTALPPQPPGYPVMPNRELPQLTPEGPYGRPNGHGLPLHAPVHSPQDPIPTHPNFHQP
FT                   MNGAPHEGSPDYRARMGYPPPDQISSAEHTPVSGALPPASQFMTPVAQMANVTPPAGYD
FT                   QAFYQNQTFGARQRKANRATQVC"
     atgaatcgca tgcctccccc ggaagctcac cacacgcacg cgggtccgca tacagcatat        60
     gatccctcat ggcgtcctcc atacccccca gctttcgata accacccatc cgactcccgc       120
     cgctcctccg caaactccca gacagcccta cccccacagc cgccaggata ccccgtaatg       180
     cccaaccgtg agctgccaca gttaacaccg gaaggcccgt atggtcgccc gaatggccat       240
     ggcctgcccc tgcatgcgcc cgtgcattcc ccgcaagacc caattcccac tcacccgaac       300
     ttccaccagc cgatgaatgg cgcgccgcac gagggctcac ctgattatcg cgctcgtatg       360
     ggctatccac ccccagatca gattagcagc gctgaacata cacccgtttc gggcgctctg       420
     cctcctgcct cacagttcat gacgcccgtt gctcaaatgg cgaatgtgac gccgcccgcc       480
     gggtacgatc aggcatttta ccaaaaccaa acgtttggag cacgccagcg taaggcaaat       540
     agagctacgc aggtatgtta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page