(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE486

PENCW_10.PE486       Location/Qualifiers
FT   CDS_pept        join(complement(1181429..1181453),
FT                   complement(1179735..1181182),complement(1179353..1179643))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825426"
FT                   /orf_name="Pc13g04860"
FT                   /product="Pc13g04860 protein"
FT                   /protein_id="CAP91555.1"
FT                   /db_xref="UniParc:UPI0001830EB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C0"
FT                   /transl_table=1
FT                   /translation="MFGWGSGLALPSATSEPEKERRPPADPTPLDFPVYNLSSVLENES
FT                   ESRLKEMAELLAEIKRPQDICAERFKPLNLKLETGVEVAQMIPEDNSHPVAPLPWEDTT
FT                   EPTEDNPRPLMDNGLPYPSKERYEVLEKELALDNDDAFREVARLPPREGRSRVRITQSR
FT                   KFWTGLERMAQYWDTSLDHYYERPATPDPTPPSEMDRTEDGTMQTDAGDSAAGHSLTDD
FT                   AMDVDNAQTDAPSSNGIVGEEQRPSVPLYTGRRIGNGAEMPDELRDETIRAFVEMAAWP
FT                   FGCQVTVPTLQPRLTTKNLLFPVRQTFQSSRSPRDRQIARSGMLEGPVLISQCRPETSF
FT                   RTADNAPGTGIGDVSDLFREVGGMLLAAQERAREGAVEKRPGEGKWWTMQPRFGGAPND
FT                   GILDDLVNHGHGMSLPDSMMEESTPSAQEAENASKRHKFEHPFVTSLSRRPSAMRRLTT
FT                   SEKWKILQPGPSLWDKRMSYLQIGKVQESPFDDIYMISSINHHVSILHLRVHRRYLDIL
FT                   TYGDSTFPATEGEPWHVLKLQRTRWFDLLDTNDRIEALKGVWQLFHHQLRQTRHEGDVP
FT                   VPIELPLERPL"
     atgtttggct ggggttctgg gctggccttg ccctccgcca cttcagagcc ggagaaggaa        60
     cgcagacccc ccgctgaccc tacacctctt gatttccccg tctacaacct gtcgagtgtc       120
     ctcgaaaatg agtcggagtc gagactcaag gagatggccg agctgctggc cgaaatcaaa       180
     cgcccacagg acatctgcgc ggagcgcttc aagccgttga acctgaaatt ggagacaggc       240
     gtcgaagtcg cccaaatgat ccccgaagac aactcgcacc ccgtcgcgcc cttgccatgg       300
     gaagatacca ccgaaccgac ggaagacaac ccgcgaccgt tgatggataa tggacttccg       360
     tacccctcga aggaacgata cgaagtcctg gagaaagagc tggcgttaga taatgacgac       420
     gcttttcgtg aggtggctcg attgccgcca cgtgagggcc gcagccgggt tcgtataacg       480
     caatcgagga agttctggac aggattggag cgcatggctc aatactggga cactagccta       540
     gaccattact acgagcgtcc ggcaacccca gatccgacac ctccatctga gatggaccgg       600
     accgaggatg gcacaatgca gacggacgct ggggactccg cggccggaca ctctctgaca       660
     gacgatgcga tggacgtgga taacgcacag acagacgcac cttcgagcaa cggcattgtt       720
     ggcgaggagc agcggccctc tgtcccatta tacacgggcc gccgaattgg caacggggcc       780
     gagatgcccg atgaactacg tgacgagacc attcgagcct ttgtggaaat ggccgcatgg       840
     ccattcgggt gccaggtcac ggtccccacg ctccaacccc ggttgaccac caagaacctc       900
     ctattccccg tccggcaaac attccaatcc tcacgatccc cgcgagaccg ccagattgcg       960
     cggagcggca tgcttgaagg ccccgttctc atctcacagt gtcgacctga gacgtctttc      1020
     cgcactgcgg acaatgcccc cgggaccggg attggcgatg taagtgattt attccgcgag      1080
     gtgggcggca tgcttctcgc ggcacaagag cgtgcccgcg aaggcgcagt ggagaagcga      1140
     cccggcgaag gcaaatggtg gaccatgcag cctcgctttg gtggcgcgcc caacgacggg      1200
     atcctggatg atcttgttaa ccacggacac ggaatgtccc tgccggactc aatgatggaa      1260
     gaaagcacgc catctgccca ggaggcagaa aacgcttcca aacgtcacaa gttcgagcat      1320
     ccgtttgtca cgtctctctc ccggagaccg agtgctatgc gcagacttac taccagtgag      1380
     aagtggaaga ttctacagcc tgggcctagt ctttgggata agcggatgag ctatttgcag      1440
     ataggcaagg tccaggagag tccctttgac gatatttaca tgatctcatc tatcaaccac      1500
     cacgtatcaa tcctccacct ccgcgtccac agacggtatc tggacatcct cacctacggc      1560
     gacagcacct tcccagcaac cgaaggcgag ccgtggcatg tgctgaagct gcagaggact      1620
     cgatggttcg acctgctcga caccaacgac cgcatagaag cgctgaaggg tgtgtggcaa      1680
     ctattccacc accagctgag acaaacacgc cacgaaggcg acgtcccagt cccgatagaa      1740
     ttacctttag agcgtccatt atag                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page