(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE487

PENCW_10.PE487       Location/Qualifiers
FT   CDS_pept        1182936..1184210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672739"
FT                   /orf_name="Pc13g04870"
FT                   /product="Putative uncharacterized protein Pc13g04870 "
FT                   /protein_id="CAP91556.1"
FT                   /db_xref="UniParc:UPI0001830EB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C1"
FT                   /transl_table=1
FT                   /translation="MPSTFSAIDTPSTPLNFIGTWSTGSSNLVTVTSIETETIYPTWIY
FT                   TISGSGPDSSTTTTVLNLSSSTLNPTQVTVTQTTKLSTTEQETIISSSSSTSTVISESP
FT                   MSPVILTTSVLSGQMGDLPFSATAKSSDHSWYSDAPSSIWTLPIPLIPSTSASVPLSSS
FT                   LPVLPETATSSVSHMSSISTPASSIIAATETPTISPSIGTVTSESSSEPSQADNPSPTS
FT                   SKIGMIVGSIIGGSAVTIFALLACALYMRRRRRKNAAERQGIRQKLIRGDSTSSSISHH
FT                   RHHSYPSIPGNISLRSPILPFIPLQQQPSNPDLSLDSMYLRGETRAQDPFADPPSTVIE
FT                   ISAPTRSASLYSTSSLGAGVGARGYWDCEREGANALAVPNEYSDTPVMRDSMRSDPFDL
FT                   DLEPPPSAHHRSSVPSISSTWGVKF"
     atgccgagta ctttctccgc cattgatact ccctccacgc cgctcaactt catcgggacg        60
     tggtccacag gctcctccaa tctggtgaca gtcacgtcaa ttgagacgga gactatttat       120
     cccacatgga tctacacgat atctggctcc ggacctgatt ccagtaccac aaccactgtg       180
     cttaacctct catcgtcaac gctgaacccg acccaggtga ccgtgactca gacgactaag       240
     ctgtcgacaa ctgagcagga aaccataata tcgagttcca gctctacatc aacagttatc       300
     tccgagtccc caatgtcgcc tgtgatccta acaacttcag ttctatcagg ccaaatgggg       360
     gacttacctt tttccgcaac ggcgaaatcg tccgatcact cctggtattc tgatgctcct       420
     agtagcatat ggactctacc gattccatta attccatcaa ctagcgcgag tgtacctctt       480
     tcatcatcac tgcctgtctt gccggagaca gccactagct ctgtcagcca catgagttcc       540
     atcagtaccc cagccagctc gatcatcgca gcaacagaaa cacctacaat ctcaccatcc       600
     atcggaaccg tcacgagtga aagctcttcg gaaccatccc aagccgacaa cccaagcccc       660
     acatcctcca aaatcggaat gatagttgga agcataatcg gaggatcagc agtcactatc       720
     ttcgccctgc tagcctgcgc actgtatatg cgacgtcgac gacgaaaaaa cgcagcggag       780
     cgtcaaggta tcagacagaa actaattcga ggcgattcaa cgagctcgtc aatcagccac       840
     caccgccacc actcctaccc ttcaatccca ggcaacatca gcctgagatc ccccatcctc       900
     ccattcatcc cattgcaaca gcagccttca aatccagacc tatctctgga cagcatgtat       960
     ctgcgcggcg agacaagagc gcaagacccc ttcgcggacc cgccgtctac agtcatcgag      1020
     atctccgccc caactcgctc ggcctcgctc tactccactt cttccctagg cgccggggtg      1080
     ggtgcacgtg ggtactggga ctgcgagcgc gaaggcgcga atgccctcgc tgtgccaaat      1140
     gagtactcgg atacgcctgt gatgcgtgat agcatgcgca gtgacccctt cgatcttgat      1200
     cttgagcctc caccgagtgc tcaccaccgg tcttctgttc cttcgatctc gtctacgtgg      1260
     ggtgtcaagt tttag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page