(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE488

PENCW_10.PE488       Location/Qualifiers
FT   CDS_pept        join(complement(1185988..>1186285),
FT                   complement(1185728..1185878),complement(1185451..1185594))
FT                   /codon_start=3
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15951952"
FT                   /orf_name="Pc13g04880"
FT                   /product="Pc13g04880 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91557.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="UniParc:UPI0001830EB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C2"
FT                   /transl_table=1
FT                   /translation="ADRVFHHHRVNLTTQKRLAASVVGCGKRKIWLDPNEMSEISNANS
FT                   RQTIRKLVSDGLIIRKPVTMHSRASARELNEARRNGRHRGLGKRKGTKDARMPSQVLWM
FT                   RRMRVLRRLLVRYRAAGKIDKHLYHELYHLSKGNTFKHKRALVEHIQKAKAERARDRVL
FT                   KEEMDAKRAKNKALRERRLERKEAKRDALINEE"
     atgctgaccg ggtctttcat caccacaggg tcaaccttac cacccagaag cgcctcgccg        60
     cctccgtggt cggctgcggc aagcgcaaga tctggctcga ccccaatgag atgagcgaga       120
     tctccaacgc caactctcgc cagaccatcc gcaagctcgt cagcgatggc ctgatcatcc       180
     gcaagcccgt caccatgcac tcccgtgcca gcgcccgtga gctcaacgag gcccgccgca       240
     acggccgtca ccgcggtctg ggtaagcgca agggtaccaa ggatgcccgt atgcccagcc       300
     aagtcctctg gatgcgccgc atgcgtgttc tccgtcgtct cctcgtccgc taccgtgccg       360
     ccggcaagat cgacaagcac ctctaccacg agctctacca cctgagcaag ggtaacacct       420
     tcaagcacaa gcgtgccctc gttgagcaca tccagaaggc taaggctgag cgtgcacgcg       480
     accgtgtcct caaggaggag atggatgcta agcgtgccaa gaacaaggct ctccgtgagc       540
     gccggttgga gcgcaaggag gccaagcgcg atgctctgat caacgaagag taa              593
//

If you have problems or comments...

PBIL Back to PBIL home page