(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE49

PENCW_10.PE49        Location/Qualifiers
FT   CDS_pept        join(114755..114975,115059..115185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948700"
FT                   /orf_name="Pc13g00490"
FT                   /product="Putative uncharacterized protein Pc13g00490 "
FT                   /protein_id="CAP91118.1"
FT                   /db_xref="UniParc:UPI0001830E97"
FT                   /db_xref="UniProtKB/TrEMBL:B6H187"
FT                   /transl_table=1
FT                   /translation="MGGDNLDALCFAGQTVELPEALGLLEPEYVFLETGRVLPGNDTGI
FT                   PGSPCSPRSPYLSPKEPDFRSQEPSSLQPGPRVPRNLYCFPRRREKRHVQHRSFDCRVI
FT                   NQGPLGLFSFI"
     atgggtggcg ataatctaga cgccctttgc tttgcagggc agacggttga gctcccagaa        60
     gcactcggtc tcctagagcc tgaatatgtg ttcctggaaa ccggacgcgt gctcccaggg       120
     aacgacacgg gtattcctgg gagcccatgc agtcctagga gcccatactt gagccccaag       180
     gaaccagact tccgttccca ggaacctagc agccttcagc cgggccctcg tgttcctagg       240
     aacctgtatt gctttcctag gagaagggaa aagcgtcatg tgcaacatag aagcttcgat       300
     tgtagggtga taaaccaagg gccattagga ctcttctcct tcatctag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page