(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE490

PENCW_10.PE490       Location/Qualifiers
FT   CDS_pept        join(1195722..1196484,1196542..1198087,1198158..1199455,
FT                   1199505..1199718,1199780..1200107,1200174..1200383)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825428"
FT                   /orf_name="Pc13g04900"
FT                   /product="Pc13g04900 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91559.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001830EB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G7"
FT                   /transl_table=1
FT                   /translation="MPPSSKKKKKPASNPARGFATVSMPSKPKPEAATTPSSAAEESKP
FT                   TPENEPQPERTDVRTADAAAPPTTSSLQDYTPEELEKHLEEAELQILVDKYAFKCKNDA
FT                   TRQATKLDNERRVFRQQSVTLSLLEWLPTDIQDSILELGSTEEHDYLITSGRVPSSKQA
FT                   GSDEDLYNKLWTLKETLLKLDFPANRVEDALKHVLQYFAGNSANAGRDVVWNLDEAIEW
FT                   LATHSDKNELPSYTQTNTRQLKDTDSVTSWMTESKGSGTSTPISSQNRSKQENKKVDWK
FT                   AEKAATPLSYDSDSSVDPDIMVPEWLELQTQLYSLDPDLFDRPGKGKKGRGGAGNLSDD
FT                   PETSKVQRKIAKIERDVLFERREAEYIWEQKLDELRKDASFIRRPVDKKKKSPTDAEDQ
FT                   PKPEINEEIDPALLAIDGMEDALGDLFQGEAEDPGSILGIAPPESQTPVILRDFGKSTG
FT                   LSPRRVLEETCKSRDSSCVVVYQDFSSSGHSNRKALEVRWSKPQEVPFPLAVESITHKS
FT                   NALATFVSMDALATPTAQQAEGYVSTLALFILFPQNSKEGKAYLRLPAVWRDLWTEFAT
FT                   LQKTQQDEVDKSTLKELKLLIQENQGTFEDDVVLSDNFRKRNGVGSKPGTPVEGSTRDS
FT                   YPGIDDRLKEAWMAKSSTPSYQRMIQGRMNLPIWGFKDEILSTLDDHRALIICSETGSG
FT                   KSTQIPSFVLEHEMVHGRPCKIYVTEPRRISAISLARRVSEELGESKNDVGTNRSLIGF
FT                   AVRLESKFTQSTPLIYATTGVVVRMLERPEDFQDITHVVLDEVHERTIDSDFLLIVLRR
FT                   LMQKRPDLKLILMSATLDAQRFSNYLGGVPVLNIPGRTFPVEMKYLEDAVEMTNYRLSE
FT                   DVQHTVLDDDMDDPPTDADTTGGLQSSLDGYSRQTKETVINIDEYRLDYELIKRLLLKL
FT                   ATAPEMAHYSKAILIFMPGLAEIRRLNDEILSEPMFQRGWIVHTLHSSIASEDQEKAFN
FT                   VPPEGTRKIVIATNIAETGITIPDITAVVDAGKEKIMRFDERRQLSRLVESFISRANAK
FT                   QRRGRAGRVQNGICFHLFTKHRHEKLLSEQQTPELLRLSLQDLVLRVKICKLGEVEQTL
FT                   LEALDPPSSKNIRRAIDSLKEVKALTSNESLTSLGTQLAKLPLDVFLGKMIIHGAFFRC
FT                   LDATVSIAAILSSKSPFVNTIGSNSQRDGARASFRRGDSDLLTVYNAYCSWRRIRSTPG
FT                   SNEYSFCRKNFLSPQTLLAIEDIKMQLVVSIADAGLLTLDASQKAALNRARSNSRNRQF
FT                   FVIPEDFDINSNNDIVVNSVIAWSFYPKLLTREGKGWRNVGNNQTVTLPAVSVNKRADS
FT                   SVKWLSYYSIMARARNLSAHDTSAVDDFAIALLCGDAEFKMYAGVVSIDANRIRFAVRD
FT                   WKSMLALKILNSRLREILSNTFRNPHRPLSYKHQQWIDIWQQIFAQAGKR"
     atgccgccga gcagcaagaa aaagaagaag cccgcctcca acccggctcg aggctttgca        60
     acagtctcta tgccctcaaa gcctaagcca gaggcagcaa caacaccgtc ttcagccgcc       120
     gaagaatcaa aacccacgcc ggaaaacgag ccgcaacctg aacgcaccga cgtacgaacc       180
     gcagatgccg ctgcaccacc aacaacctcc tccttacagg actacacacc ggaggagctg       240
     gaaaaacatc tcgaagaagc agagctccag attttggtcg acaaatacgc tttcaagtgt       300
     aaaaatgacg caacgcgcca ggccaccaag ctggacaacg aacgccgtgt tttccgacag       360
     caatcagtta cattgagcct tctggagtgg ttgccgacag atattcaaga cagcattctc       420
     gaactgggta gcaccgaaga gcatgactat cttataacaa gtggtcgggt cccaagttca       480
     aaacaggctg gctccgatga ggatctatat aacaagcttt ggaccttgaa ggaaacactg       540
     ctcaaactcg acttcccagc aaaccgcgtc gaggatgcac tgaagcatgt tttgcaatat       600
     tttgctggca actcagccaa tgccggtcgg gacgttgtgt ggaaccttga tgaagcaatt       660
     gaatggttgg ctacgcacag tgataagaac gaattgccat cttacacaca gacaaatact       720
     cgccaactaa aagacacgga tagtgtcacc tcgtggatga cagaatcgaa aggctcaggg       780
     acttcgactc ctatttcatc ccaaaatcgg agcaagcaag aaaacaaaaa ggtagattgg       840
     aaggcggaaa aggctgccac tcctctttca tacgactcgg acagctcagt cgacccagat       900
     atcatggtgc ccgaatggct ggaactgcag actcaacttt acagcctgga tccagatctc       960
     ttcgatcgtc ccgggaaggg caagaaaggt cgcggcggtg ctggcaattt gtcagatgac      1020
     cccgaaacct ccaaagtgca gcggaagatt gctaagattg aacgtgatgt gcttttcgaa      1080
     cgccgagaag ctgagtacat atgggagcaa aagcttgacg agctcagaaa ggacgcgtca      1140
     tttattcggc gcccggtgga caaaaagaaa aagtctccga ccgatgcaga agatcagccg      1200
     aagcccgaga tcaacgaaga gatagacccg gccctccttg cgatcgacgg aatggaggat      1260
     gcccttgggg acttgttcca aggcgaagct gaggatccag gctccatttt aggtattgct      1320
     cctccagaga gccagacccc ggtcatactc cgcgactttg ggaaatcgac gggcctgagc      1380
     ccacggcgag tcttggagga gacttgcaaa tcaagagact cctcttgcgt ggttgtctac      1440
     caagattttt cctcttcggg tcattcgaac agaaaggctc tcgaggtgcg atggtcgaag      1500
     ccccaagaag tcccgttccc gttagcagtg gaatccatta cacacaagtc gaatgccttg      1560
     gctacgtttg tgtcaatgga tgccctcgca acaccgactg cgcagcaggc tgaggggtac      1620
     gtgtcgactc tggctttgtt catcttgttc cctcagaatt ccaaggaagg caaggcctac      1680
     ctgcggctgc cagccgtttg gagagacctc tggactgagt tcgcaacact gcagaagact      1740
     caacaagatg aagtcgataa atctactcta aaagagttga agcttctgat ccaagaaaac      1800
     caaggcacgt tcgaagatga cgtcgtccta tctgacaact tccggaagag aaacggcgtt      1860
     ggtagcaagc caggtacccc ggtggagggg tctacgcgtg acagttaccc gggtatcgat      1920
     gaccgcctga aagaagcttg gatggctaaa tcgtcgacgc cttcgtatca acgcatgata      1980
     cagggtagga tgaacctccc aatctggggg ttcaaagatg agatcctgag tacgctcgat      2040
     gatcaccgag ctctgatcat ttgcagtgaa actggtagcg gaaagagtac acagattccg      2100
     tcattcgttc tcgagcacga gatggtccac ggtcgtccat gcaagatcta tgtgaccgag      2160
     ccccgccgta tctccgcaat ctcgcttgct cgacgtgtca gcgaggagct tggagagagc      2220
     aagaacgatg tgggcacgaa tagatctctc attggatttg cggtgcgact ggaaagcaag      2280
     tttacccaat ccacgccgtt gatctatgca accaccggag tggtcgtacg aatgctcgaa      2340
     cggcccgagg atttccaaga catcactcat gtggttcttg acgaagttca cgagcgcacc      2400
     atcgacagtg acttccttct gatcgtgctc cgacgactca tgcagaagcg gcctgaccta      2460
     aaactcatcc tcatgtccgc cactctcgat gcgcaacgtt tttcgaatta tctcggcggt      2520
     gtgccagttc tgaacatccc tgggcgaacc ttccccgtgg aaatgaagta tctggaggat      2580
     gcagtcgaga tgaccaacta ccgtttgtcg gaggatgtgc agcacacagt cctcgacgat      2640
     gatatggacg acccacccac ggatgccgac accacaggag gcctccaatc cagtcttgat      2700
     gggtactcta gacagaccaa ggaaactgtt atcaacatcg acgagtacag actggactat      2760
     gagctgatca agaggttgct cctgaagctt gccaccgccc cggagatggc tcactacagc      2820
     aaggcgattt tgatcttcat gcctggactg gcggaaattc gccgcctgaa cgacgagatc      2880
     ctgtccgagc ccatgttcca gaggggttgg attgtgcata cgcttcactc ttcgattgcc      2940
     agcgaagacc aagaaaaggc cttcaatgta cccccggaag gcacaagaaa gattgtcatt      3000
     gcaacgaaca ttgcggaaac aggtatcacc atcccggata tcacggctgt tgtcgacgca      3060
     ggaaaggaga agatcatgcg cttcgatgag agacgtcaat tgtcccgcct tgttgagtca      3120
     ttcatctcac gtgcgaacgc taaacagcgt cgcggtcgtg ctggacgtgt tcagaacggt      3180
     atctgcttcc acctgttcac taaacatcgt catgaaaagt tgctctctga acagcaaacc      3240
     cctgaattgc tgcgcctttc tctacaggat ctggtgcttc gtgtgaagat ctgcaaattg      3300
     ggagaagtgg aacagactct cctcgaagct cttgatccgc cgtcgtctaa aaacattcgc      3360
     cgcgccattg actcactgaa ggaagttaaa gcactgacta gcaacgagag cttaacctct      3420
     ctcggcacac aactggccaa gttgccgttg gatgtcttcc tcggcaaaat gatcattcac      3480
     ggagccttct tccggtgctt ggatgcgact gtcagcattg ctgctatcct ttcttccaag      3540
     tcaccatttg tgaacacaat cggatccaac tcacaacgcg acggtgcgcg agcgtctttc      3600
     cgaagaggtg actcggatct tttgactgta tacaacgcct attgcagttg gagacgcata      3660
     agaagcacac cggggtccaa cgagtattct ttctgccgaa agaacttcct cagcccgcag      3720
     acgttgctgg ctatcgagga tatcaagatg cagctggtag tgtcaatcgc cgacgcaggt      3780
     cttctgaccc tggacgcatc ccagaaagca gccctcaacc gtgcacgctc taacagccga      3840
     aaccgccaat tcttcgtcat ccctgaagat ttcgacatca acagcaacaa tgatattgtg      3900
     gtcaactcag tcatcgcctg gagtttctat cctaagcttc tgacgcgcga aggcaagggt      3960
     tggcgcaatg ttggcaacaa ccagacagtc actctacccg ctgtttctgt caacaagagg      4020
     gcagactcgt ccgtcaagtg gctgtcatac tatagcatta tggcacgtgc ccgaaacctc      4080
     agcgcgcatg ataccagcgc agttgacgat tttgccatag ccttgctgtg tggtgatgct      4140
     gagttcaaga tgtatgctgg tgttgtctcc attgacgcaa accgcattcg attcgctgtg      4200
     cgagattgga agtctatgct agccttgaag atcttgaaca gccgcctgcg cgagatcctt      4260
     tcgaacactt tccgcaaccc ccaccgtccg ttgtcatata agcatcagca gtggatcgac      4320
     atatggcaac agatctttgc tcaggctggt aagcgatga                             4359
//

If you have problems or comments...

PBIL Back to PBIL home page