(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE491

PENCW_10.PE491       Location/Qualifiers
FT   CDS_pept        join(complement(1202580..1202700),
FT                   complement(1201505..1201844),complement(1201323..1201410),
FT                   complement(1201135..1201224),complement(1200948..1201028),
FT                   complement(1200773..1200853))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825429"
FT                   /orf_name="Pc13g04910"
FT                   /product="Putative uncharacterized protein Pc13g04910 "
FT                   /protein_id="CAP91560.1"
FT                   /db_xref="UniParc:UPI0001830EB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G8"
FT                   /transl_table=1
FT                   /translation="MTGCGNNHVGRARSCGFTASCPPLRADVAQSIISYSVAPSGVASR
FT                   SKNANTMQRAAQAASIMYDEESDKLACQVPAQGQEQVPVPPGDWVAVHEIVYIVSNRSQ
FT                   PDYRLWVRIIPGWAGARGDFHLLEVCLPFRLCMECRWRMGVGGWCILCLGNVWGVGMDG
FT                   VDSWNLPRFSCVFRPHDLAEVGISLDWGLGWRDCIVAAGRRRPIVSRGKMLCLDHDLIG
FT                   VAMIMQSFTHVGSVLTASYAVSRRSCRDATVPADRSPGSYLLSG"
     atgactggct gcgggaacaa ccacgtagga agggctagat cgtgtggatt caccgccagt        60
     tgccccccct tgcgtgcaga cgtggcacag agcattatct catactccgt agctccatct       120
     ggcgtcgcta gtcgatcgaa gaatgcaaat accatgcagc gtgcagccca agctgcaagt       180
     attatgtacg atgaagagag tgacaagcta gcttgccaag tgccagcgca aggccaagag       240
     caggtgccag tgccgcccgg agactgggtt gctgtgcatg aaatagtgta catagtttca       300
     aacagatcgc agcctgacta ccgtctatgg gtgcgaatca ttcccgggtg ggctggggca       360
     cgtggggact tccaccttct cgaagtatgt ctgccattca gattgtgcat ggagtgcaga       420
     tggagaatgg gtgtgggtgg atggtgcata ttgtgtcttg ggaatgtctg gggggtgggg       480
     atggatgggg ttgacagctg gaatcttcca aggttctcct gtgtgttcag acctcacgac       540
     ctcgcagagg ttggtatatc ccttgattgg ggtttgggat ggcgggattg cattgttgca       600
     gctggtcgtc gtagaccgat tgtttcccgt gggaaaatgt tgtgccttga tcacgatctg       660
     ataggggtgg cgatgataat gcaatcgttt acgcacgtcg gatcagtgct gacggcgtcg       720
     tatgctgtct cccgtcgttc atgtagggat gctacggttc ctgctgatag atcgccggga       780
     tcatatctat tgtctgggta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page