(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE492

PENCW_10.PE492       Location/Qualifiers
FT   CDS_pept        join(1208042..1208125,1208372..1209329,1209404..1209536,
FT                   1209597..1210878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951953"
FT                   /orf_name="Pc13g04920"
FT                   /product="Pc13g04920 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP91561.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniParc:UPI0001830F7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G9"
FT                   /transl_table=1
FT                   /translation="MCSTIVNDLDDYCASLNSSFSKSLYCASHDGRHLRRPLLASSLYS
FT                   KPFIRATEKLELPSISQVHTRGPADIPWYNPHAAERPLLPGDKLPALSLPTATQGLSRT
FT                   AYPDPSVTNSTNSSARTSLSSASVPVNEPRSPPSSADLSGTQGRLSLDSSAPTEYSLPP
FT                   SVNEGYYPSPTSLGSMNQTQPYMDVHSHMSSAQSYAPQGATAGAMSQYQYHGQPPVMQP
FT                   ASSYAPAAYPQYGYPTGVTSPPTGHPPSSMGGQMPAQLLPLPGKLQSQNVIEDYSDRYQ
FT                   VSNHAVAPPSGYGNSTGAPLQGFVFDGTGQVAPPGAKPRVTATLWEDEGSLCYQVEAKG
FT                   VCVARREDNHMINGTKLLNVAGMTRGRRDGILKSEKLRHVVKIGPMHLKGVWIPFERAL
FT                   EFANKEKITDLLYPLFVHNIGGLLYHPANQTRTNMVVQESQQRRLEGPPPGPQRTPSGS
FT                   QQGPIHHHHPSLQTPMSSHMSQGPMNGQPGSRPGLERANTFPTPPASASSMMNQGSSYE
FT                   WGGQVPHTQPLSIDTTLSNQRSMPTTPATTPPGNNMQGLPAYQGQGYDSSKPYYSAAPQ
FT                   THAQYAPHTPLTQSGMSSYGQPLAGGYMKSEMAPPNPRPGVSEPETSERDSNRYSQSNG
FT                   PGETVAEHDQEYMQDHNAGYNSNRGSYTYTTNPSVSSLTGEHSQLTPEMTSSPSQQNGS
FT                   GRMTPRTGAGPPPHWASGYNTPPRPAATTLYNAVSDTRGTPANGASDPYSMASTTAPVY
FT                   PTGNGSLSAGSKRMREDDDIRAESTAEYETSKRRKTITDATLGGPVGGPPILQPMKPSG
FT                   VMARHR"
     atgtgttcga cgattgttaa tgatcttgat gactattgtg cttctctgaa ttcgtctttt        60
     tcaaaaagtc tttattgcgc ttctcacgac ggacgacatt tacgacgtcc gctgctcgct       120
     tcatctctct attctaaacc gtttatccgt gcaaccgaaa agctggagct gccatcgatc       180
     tcgcaggtcc atacccgcgg tcctgctgac atcccctggt acaaccctca cgcggcggaa       240
     cgaccgttat tgcccggcga caaactcccc gctctcagcc tgccaacagc cacccagggc       300
     ctctcccgga ccgcctatcc agacccgtct gtgaccaatt ccaccaactc tagcgctcgc       360
     acgagtctgt ctagtgcttc tgtgcctgtc aacgaaccta ggagtccccc gtcctctgcg       420
     gacctgtctg ggacccaggg ccgtctttca ttagattctt ccgccccgac tgaatacagt       480
     ctcccgcctt cggtcaacga agggtactat cctagcccga cttctctcgg cagcatgaac       540
     cagacccagc cgtatatgga tgtccactcg cacatgtctt ctgctcagtc atacgctcct       600
     caaggcgcaa ccgcaggcgc aatgtcccag tatcagtacc acggacaacc ccctgtgatg       660
     cagcccgcgt cttcttacgc cccggctgct tacccccaat acggataccc cactggcgtc       720
     acgtcaccgc caacaggaca cccaccaagc tccatgggtg gccagatgcc ggctcagctg       780
     ctgccgttgc ctggtaagct ccaaagccag aacgtgatcg aagattattc tgatcgttat       840
     caagtgagca atcacgccgt ggcgcctccg agcgggtatg ggaacagcac tggcgctccg       900
     ctacaagggt tcgtatttga tggtactggt caagttgctc ctccgggagc gaagccgcga       960
     gtgacagcca cattatggga agatgagggg agcctctgct accaggtgga agcgaagggg      1020
     gtgtgtgtag ctcgacgaga ggacaaccac atgatcaatg gtacaaagct gctaaatgta      1080
     gctggcatga cccgtggtcg acgtgatgga attctcaaaa gcgaaaagct tcgccacgtt      1140
     gtgaaaattg gaccgatgca tttgaaaggt gtctggatcc catttgagcg tgctctggaa      1200
     tttgccaaca aggagaagat caccgatctg ttgtacccac tctttgtgca taatattggt      1260
     ggtcttctat accacccggc caaccagact cggacaaaca tggtagtgca agagtcccag      1320
     cagcggcgtt tggaaggccc tcccccgggc ccgcagcgca cgccgtctgg ctctcagcaa      1380
     ggcccgattc accatcacca cccctctttg cagaccccca tgtcttctca tatgtcccaa      1440
     ggcccaatga atggccagcc tggctccaga ccaggcctcg agcgtgccaa cacctttcct      1500
     acaccgccag ccagtgcatc cagcatgatg aatcaaggca gctcatacga atggggcgga      1560
     caagtgccac acacgcagcc cctgtccatc gacaccacac tgagcaacca gcgctcaatg      1620
     ccaaccaccc ccgcgaccac cccaccgggc aacaacatgc agggcttgcc agcctaccaa      1680
     ggccaaggat acgacagctc caagccctac tattccgcgg cgccacaaac acacgcccaa      1740
     tacgcgccgc acaccccgct cacccaatca gggatgtcca gctacggcca acccctggct      1800
     ggcgggtaca tgaaaagcga aatggcgcca ccaaacccac gcccgggcgt ctccgagccc      1860
     gaaacctccg agcgcgactc aaaccgctac agccagagca atgggcccgg cgagaccgtc      1920
     gccgagcacg atcaggagta catgcaagac cacaacgccg gctacaactc caaccgcggc      1980
     tcctacacct acaccaccaa cccctccgtc agttccctca ccggcgaaca ctcccagctc      2040
     accccggaga tgactagctc cccgagccag caaaacggct ctggtcgtat gaccccgcgc      2100
     acgggcgccg gcccccctcc tcactgggct tcggggtata acactcctcc tcgtcccgcc      2160
     gccactaccc tgtacaacgc tgtcagcgac actcgcggta ccccggccaa cggtgcttcg      2220
     gacccttact ccatggcatc gaccacggcc ccggtctacc cgactggaaa tggctcgctg      2280
     agtgcgggca gcaagcgtat gcgtgaggat gacgatatcc gtgccgagag tacggctgag      2340
     tacgagacct cgaagcgccg caagaccatc accgatgcta ccctcggcgg tccggtcggt      2400
     ggtccgccta ttcttcaacc gatgaagcct agcggggtca tggctcgtca tcggtga         2457
//

If you have problems or comments...

PBIL Back to PBIL home page