(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE493

PENCW_10.PE493       Location/Qualifiers
FT   CDS_pept        join(complement(1213930..1214166),
FT                   complement(1213004..1213870))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825430"
FT                   /orf_name="Pc13g04930"
FT                   /product="Pc13g04930 protein"
FT                   /protein_id="CAP91562.1"
FT                   /db_xref="UniParc:UPI0001830F7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2H0"
FT                   /transl_table=1
FT                   /translation="MHMRTLLLLIWAIAAPALGWRGEMPAQRSYMYVGGQYILNSAGQH
FT                   VFADQMYVEKLTPAAGITKPYPIVFIHGQAQTGTNWLNKPDGGEGWASYFLSQGYACYI
FT                   IDQTFRGRSAWFPGNGTMNTYSAELLQQRFTAPKLYNLWPQASLHTQWNGTGVMGDPNF
FT                   DNYYSSTVEFLSSATHQQSTVQAAGATLLDTIGSPVILIAHSQGGTIPWLLADVRPNLV
FT                   HSIVSIEPTGPPFQDAVFSNSSTRAYGLTDIPLTYSPALADPVELVKHVIPSNSSLYSD
FT                   CVIQADSPAPRQLVNLAGVPILVLTTESSYHAPYDWCTVKFLQQAGVPAEHLQLADIGI
FT                   HGNGHMVFMEKNSLQVAAVLQKWMERT"
     atgcatatga ggacattatt attattgatc tgggcaattg ctgctccagc tttaggctgg        60
     cgcggtgaga tgccagccca gcgatcgtac atgtatgttg gaggacaata cattctgaat       120
     agtgctggcc aacatgtctt cgcggatcag atgtacgtgg aaaaactgac tccggccgcg       180
     ggtattacga agccgtatcc aattgtcttc atccatggac aagctcaaac cggcactaat       240
     tggctcaaca agcctgacgg aggggagggt tgggcctctt actttctctc tcaaggatac       300
     gcatgctata tcatcgacca aaccttccgt ggccgcagtg cctggttccc cggcaatggg       360
     acaatgaaca cctacagcgc cgagctgttg cagcagcgct tcaccgcgcc caaactgtac       420
     aacctctggc cgcaggcctc cctgcacacc caatggaacg ggacgggcgt catgggcgac       480
     ccaaatttcg acaattacta ttcctcgacg gtggagttcc tcagttcagc aacccaccag       540
     caatcgaccg tccaggccgc cggcgccacc ctgctcgaca ccatcggatc cccagtcatt       600
     ctcatcgcgc actcccaggg cggaactatt ccctggctcc ttgcggatgt gcgcccgaat       660
     ctcgtccact ccatcgtttc aatcgagccg actggtcctc ccttccagga cgctgtcttc       720
     agcaattctt ccacgcgtgc ctatgggctt accgatatcc cgctaaccta ctcaccagcc       780
     ctggccgatc cagtcgagct ggtgaaacac gtcatccctt ccaactcgtc gctgtactcc       840
     gactgcgtaa tccaggccga ttcccccgca ccgagacagc tcgtcaatct cgccggggtg       900
     cccatcctgg tcctgacgac cgaatcgtct taccacgcgc cgtatgactg gtgcacagtc       960
     aagttcctgc aacaggcagg tgtcccggcg gaacatctgc agctggcgga tatcggcatc      1020
     catggaaatg gacatatggt gttcatggag aagaatagtt tgcaagttgc tgctgttctg      1080
     cagaagtgga tggagcggac gtaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page