(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE494

PENCW_10.PE494       Location/Qualifiers
FT   CDS_pept        join(1214528..1214721,1214835..1215073,1215140..1215171,
FT                   1215199..1215320,1215377..1215776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951954"
FT                   /orf_name="Pc13g04940"
FT                   /product="Pc13g04940 protein"
FT                   /protein_id="CAP91563.1"
FT                   /db_xref="UniParc:UPI0001830F80"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D6"
FT                   /transl_table=1
FT                   /translation="MDSTLIILWVFTWVAIGLIVLRLLLRKLKGRQFILGDYFAMGAIL
FT                   CALVRLALVHVILIWGTNNMLNGIAGSSRYFFSHVSFSLWLQKLVLLDTYRRLLTNLRW
FT                   EKATMISYIGIFAATYIIVQIVTFTECDPFSHYWMVLPDPGICCRAQLQLIVVSMHSSN
FT                   IVVPSGVLNVITDIMLIALPIPILVLVKRSTIEKIQLAALFAVGLFIVAITIARLPQNA
FT                   KNSTAQVNRTTWASIELLAAAIVANAPVLYGLLKGQSERSKNAASGAGSTGPSQGIKKR
FT                   PANEPEFELQRTRHSKRGSALGSRISSRNYLEIDGESSQSLTRSLEN"
     atggattcca ccctcatcat cctttgggtg tttacctggg tggcaatcgg cttgattgtg        60
     cttcggctgc tactgcgaaa gttgaaagga cgccagttca tcctgggcga ttattttgca       120
     atgggagcga ttctctgtgc actcgtacgc ctcgccttgg tccatgttat tctcatctgg       180
     ggaaccaaca atatgttgaa tggaattgca gggtcgtccc gctatttctt ttctcatgtt       240
     tcttttagtc tctggttgca aaaattggtt ctgcttgata cctaccgcag actgctcacc       300
     aacctccggt gggagaaggc cacgatgatc tcatatattg ggatattcgc tgccacgtat       360
     ataatcgtac aaatcgtgac tttcacagag tgcgatccat tcagccatta ctggatggta       420
     ttgccggatc ctggcatatg ctgccgggca cagctgcaat tgatcgtcgt ttcaatgcat       480
     agctctaaca ttgtagttcc atcaggcgtc ctaaatgtca tcaccgatat tatgcttatc       540
     gccttgccaa ttccaattct ggttctggtt aaacgatcca ccattgaaaa aatccagcta       600
     gcggccctct tcgccgtcgg tcttttcatt gtcgcaatca ctatcgctag actaccccaa       660
     aacgccaaaa actccaccgc acaagtaaac agaaccactt gggcgtccat tgagttacta       720
     gctgccgcta tcgtcgctaa cgctcccgtc ctgtacggac ttctcaaggg gcagagcgaa       780
     aggtccaaga acgcagcatc aggagctgga tcaactgggc cgtcgcaagg aattaaaaag       840
     agaccagcaa atgagcctga atttgaactg caaaggaccc gtcatagtaa gagagggtct       900
     gctcttggtt caaggatatc atctaggaat tatttggaga ttgatggcga aagtagtcag       960
     tcgttgactc gaagcctgga aaattag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page