(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE495

PENCW_10.PE495       Location/Qualifiers
FT   CDS_pept        join(1216154..1217034,1217099..1217190,1217333..1217397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129809"
FT                   /orf_name="Pc13g04950"
FT                   /product="Pc13g04950 protein"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91564.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI0001830F81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D7"
FT                   /transl_table=1
FT                   /translation="MNSDRPERERPAKPQLPEPRNHLHFDPWQSASTGHQRADQGGSFL
FT                   GSTSWRDARSAKLTMQYRSGDCLPGRGTGPGPANKTTQKTTLVPGAFDGKCASESPPKA
FT                   PASGEWAMVAGDVAKRNELDVRDIRSFMGVSKRKAVDELGNETKAEMKKPRTVSGGNGS
FT                   LSPALYAKEMDKETEKSEIEDNPQPKSRSGTGLDLKATSRIFAGVTIFINGSTLPQISE
FT                   YKLKHLLASNGAKTSIYMARKTVTHILVGQPNTGSGTGTAVSGAGGGLAASKLQQEITR
FT                   GGWKGVKVVSVDWALESIKAGRRLAESRFPGMHVAAKGQRSVAESWFPVNLLGWDDESS
FT                   NYMHL"
     atgaacagcg accgaccaga acgagaacga cccgccaaac cacaactccc agaaccccga        60
     aatcaccttc atttcgatcc ctggcagtca gcctcaacag gacaccagcg cgcagaccaa       120
     ggcggcagct tcctcggttc aacctcatgg cgagatgcgc gctcggcaaa attgaccatg       180
     cagtaccgaa gtggggattg ccttccaggg aggggaacgg gaccgggacc agcgaacaag       240
     accacacaaa agaccaccct tgtaccgggt gcattcgatg gaaaatgcgc gtccgagtca       300
     ccacctaaag cccccgcttc cggtgaatgg gctatggtag cgggggatgt ggctaagcgg       360
     aatgaactcg acgttcggga tatccggtca tttatgggtg ttagcaagag gaaggctgtg       420
     gatgaactcg gaaatgagac taaggcggag atgaagaagc ctaggactgt ttctgggggg       480
     aacggcagtc taagtccggc tctatatgca aaagaaatgg acaaggaaac ggaaaagtct       540
     gaaatagaag acaaccccca acccaagtcc cgctctggca ccggcctcga tctgaaagcg       600
     acttcgcgta tcttcgccgg cgtcacgatc ttcataaatg gctcaacgct cccccagata       660
     tcggagtaca aactcaaaca tctactcgct tcgaatgggg ccaagacctc catctacatg       720
     gcccggaaga cggtgacgca tattctcgtc ggacagccca ataccggatc tgggactgga       780
     acggctgtgt ctggcgcggg gggaggcctt gctgcgagta agcttcagca ggaaattacc       840
     cgtgggggat ggaaaggtgt gaaggtcgtt agtgtggact gggctctcga gagtatcaaa       900
     gctgggcgtc gtcttgcgga gtctcgtttc cctggtatgc atgttgctgc caaggggcag       960
     cggagtgttg ctgagtcatg gtttcccgtt aatcttctgg gctgggatga tgaatcttcc      1020
     aactacatgc acttatga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page