(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE496

PENCW_10.PE496       Location/Qualifiers
FT   CDS_pept        join(complement(1219632..1220390),
FT                   complement(1217858..1219579))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978595"
FT                   /orf_name="Pc13g04960"
FT                   /product="Pc13g04960 protein"
FT                   /protein_id="CAP91565.1"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI0001830F82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D4"
FT                   /transl_table=1
FT                   /translation="MDPNSALSHANNLLARAETSGRPPVYKAVGISLAVASGVFIGISF
FT                   VVKKIGLLKANVKYNEEAGEGYGYLKNFWWWTGMTLMIVGEICNFVAYAFVDAILVTPL
FT                   GALSVVITTILSAIFLKERLSFVGKVGCFCCIIGSVTIAMNAPEQSSVKDIQSMQHFVI
FT                   QPGFLVYAGVIIVGAAFTALWAGPRYGKSSMFVYISICSMVGGLSVVATQGLGSAILAQ
FT                   INGQEQFKHWFLYVLFVFVIGTLLTEIIYLNKALNLFNAALVTPTYYVMFTSATIITSA
FT                   ILFQGFKGTGVQIATVIIGFLQICAGVVLLQLSKSAKDVPDAAIFKGDLDQIREVAEVE
FT                   EPESEPKADSIRGTASIIRRISTARRTMETDEARRFFHDKHEDTLKVPAENEIIEWDGL
FT                   RRRKTVIGEGPTMSRPITPRTPSVKQHPPWGMSRFPAVEDEENHRPNTKQSGHSFMDSI
FT                   RSRATSVLHPSQWKAVNTEDEKSSNANTQPVGMTGLAQQNGNADAEYHGAGMAGGLEVP
FT                   FNANRPRSDTLRSVSWADEKAESLTPEPIANTARRQFSFNNMMGRMKADSESSVKPTPG
FT                   SPRGILRRTHLAADMRKSATEEESLGLVHGDSRRSQPEEELLNEKLDRWSSAESELGEP
FT                   QPMFAGRSHGNSVSSNISTAAFPAYEDNHHHYSESNNPYYLPHNRQTASSPEPISRDEE
FT                   GWKHPSSRGSGSRTRTRTNSSVHAHSRAPPPAQSSFSTHRHPNPLPPLPDITPTTTLDL
FT                   MPTATNVPALRSVSSESDMVTTLSSEIEDPNDPPPVYPSRQQSGWRRHMSDNSSHDGET
FT                   YATRGGRGSSFRRT"
     atggatccca attccgcctt atcgcatgca aacaacctcc tcgcacgcgc ggaaacctca        60
     ggccgtccac cggtgtacaa ggccgtcggt atatcgctgg ctgtcgcatc gggcgtcttc       120
     atcggtatct cgtttgtggt taagaaaatt ggactgctga aggcgaacgt gaagtacaat       180
     gaggaagctg gtgagggata tggatatctc aagaatttct ggtggtggac tggtatgacg       240
     ctgatgattg ttggagagat ctgcaatttt gtggcgtatg cgtttgtcga tgcgattttg       300
     gtgacgccgc ttggtgcact ctcggtcgtg attacgacga ttctgtcggc gattttcctc       360
     aaggaacggc ttagtttcgt gggcaaggtt ggctgtttct gttgtattat tggatcggtt       420
     actattgcta tgaatgcgcc tgagcagtcg tctgtcaagg acattcagag tatgcagcat       480
     tttgttattc agcctgggtt tttggtctat gctggggtga tcattgtggg agctgctttt       540
     acggctcttt gggctggtcc acgctatgga aagtcgagca tgtttgttta tatcagtatt       600
     tgcagcatgg tcggtggact gagtgtcgtg gctacgcagg gcttggggtc tgccattctc       660
     gctcagatta atggccagga gcagttcaag cattggttcc tctatgtctt gtttgtgttc       720
     gttatcggga cgctgttgac cgagattatt tatctcaata aagcgcttaa tctttttaat       780
     gccgctctgg tcaccccgac ttattatgtg atgttcacta gcgccaccat tatcacatcc       840
     gccattctgt tccagggctt caagggtacc ggagtccaga ttgcaactgt gattatcggg       900
     ttcttgcaaa tctgtgccgg tgtggtattg ctgcagctat ccaagtccgc caaggacgtg       960
     cccgatgctg ctattttcaa gggcgatctg gatcagattc gagaggttgc cgaggtagaa      1020
     gaacccgagt ctgagcccaa ggcagactcc attcgtggta cggcttctat catccgtcgc      1080
     atttcaactg ctcgccgcac tatggagacg gacgaagcgc gccgtttctt ccatgacaag      1140
     catgaagata ccctgaaagt accggccgag aatgagataa tcgaatggga tggcctgcgc      1200
     cggcgcaaga ctgtcattgg cgagggacca actatgtcac gaccaatcac tccacgaaca      1260
     ccctcggtca aacaacatcc accgtggggc atgtcccgat ttcccgctgt tgaggatgag      1320
     gagaaccacc gacctaacac caagcaaagc ggtcattctt tcatggatag cattcggtct      1380
     cgggctacca gcgtccttca tccttcccaa tggaaagctg taaatacaga agacgagaaa      1440
     agctccaacg ccaacactca accagtggga atgacaggcc tggcacaaca aaatggcaat      1500
     gctgatgccg aataccatgg tgccggtatg gctgggggtt tggaggttcc attcaatgca      1560
     aaccgtccgc gtagtgatac gctgcggtct gtatcatggg cggacgaaaa ggccgaatcc      1620
     ctgacaccgg aacctatcgc caacactgcc cgtcggcagt tctctttcaa caacatgatg      1680
     ggccgtatga aggccgacag cgaatcttcc gtcaaaccca caccgggctc gccccgtggc      1740
     atcctacgcc gaactcacct ggcagccgat atgcgcaagt ctgcaaccga ggaagagtca      1800
     cttggtctcg tccacggcga ctcgcgccga tcgcaaccag aagaagaact cctaaacgaa      1860
     aagttagacc gctggtcgag cgccgagtcg gaacttggcg agccccagcc catgtttgca      1920
     ggccgatcac acggcaactc cgtgtccagc aacatttcca ctgccgcatt ccctgcctac      1980
     gaggacaatc accaccacta ctccgagtcc aacaacccct actacctccc acacaaccga      2040
     caaaccgcct catcccccga gcccatctcc cgcgatgaag agggctggaa acacccttcc      2100
     tcgaggggca gtggcagcag aactcgcaca cggacaaact cttctgtgca tgcccattct      2160
     cgcgccccgc ctccagccca atcctccttc tctacccacc gtcatccaaa ccccctcccg      2220
     ccactccctg atatcacgcc caccaccacc ctcgacctca tgcccaccgc aacaaatgta      2280
     ccggccttga gatcagtctc ttcggaatcc gatatggtaa cgaccctctc cagcgagata      2340
     gaagatccca atgacccccc gcctgtctac ccgagtcgtc aacagagtgg ctggcgtcgg      2400
     catatgtctg acaacagcag ccatgacggc gagacatatg ccacacgcgg aggtaggggg      2460
     agttcattca ggagaacgtg a                                                2481
//

If you have problems or comments...

PBIL Back to PBIL home page