(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE497

PENCW_10.PE497       Location/Qualifiers
FT   CDS_pept        join(1220411..1220447,1220467..1220598,1220657..1220773,
FT                   1220874..1220953)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978596"
FT                   /orf_name="Pc13g04970"
FT                   /product="Putative uncharacterized protein Pc13g04970 "
FT                   /protein_id="CAP91566.1"
FT                   /db_xref="UniParc:UPI0001830F83"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D5"
FT                   /transl_table=1
FT                   /translation="MATLTSSGKRRRESSEDETQRLFETLGDAATISIKIGRIAGATIN
FT                   EGPASTMVPSRGNASGKCPRGKEKCGIPQGGKSAVGAKTFGGKWQGSDFEGEGKEIEMQ
FT                   NKEAGPCGERRRYWYSW"
     atggccacac tgaccagcag tgggaagagg aggagagagt cgtccgaaga cgagactcag        60
     cgactatttg aaacacttgg tgatgctgcc acgatatcga taaagattgg gcgtatcgcc       120
     ggggcgacta tcaacgaggg gcctgcgtca acaatggttc cgagtcgagg gaatgcttct       180
     ggaaaatgtc cacgaggaaa ggaaaaatgt gggattccgc aaggggggaa gtcagccgtt       240
     ggcgctaaga ctttcggtgg caaatggcag ggatcagatt ttgaggggga aggcaaagag       300
     atcgagatgc aaaacaaaga ggctgggcca tgtggggaaa ggaggaggta ctggtactcc       360
     tggtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page