(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE498

PENCW_10.PE498       Location/Qualifiers
FT   CDS_pept        join(complement(1223339..1223405),
FT                   complement(1222703..1223288),complement(1221410..1222643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951955"
FT                   /orf_name="Pc13g04980"
FT                   /product="Pc13g04980 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91567.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001830F84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D8"
FT                   /transl_table=1
FT                   /translation="MDPANLRRKDTTKGPPLRILSLDGGGVRGYSMLILLQELMYRTYV
FT                   ECEGKPPRRDQIPKPCDHFDLIAGTGTGGLIALMLGRLRLDLETCKEVYVRMTRKVFET
FT                   DKTIAGIPYRSTLFKASKLEEAIRECVREHTVYETEGNDTGNAPNRDSMASMTSLPYSP
FT                   ASIPQRSISRGSFSTAAASHPMSPTSQRGSVFLNGLRWGNPDALLYDNRENRTKTAVTA
FT                   MYKGTPRKGTAVLLRSYDSRREPPPEFDCTIWQAGRATSATGLAFKPIQIGQHHFIDEG
FT                   HGTFNPAPLVLDEAVVNEWPGREVGVFVSVGTGKRPPGTNNRQHEWWEDFFSDSLGTFA
FT                   EARRRLMTKIEGCEDIHNDMLRDRLAKRNVSKDNYFRLNVEVGVGEFGMNEWHRLADIS
FT                   TNTRQYLARPEVKKMILEAGVRFAKIDRMNRRLASHAAAGGDRDDLSFDLETEELSLSP
FT                   PVQSHVPPPAHFAVELPAELPADFVGSAHHPPPSQAPLPIPTVVTTSPTEDTLPIHPTP
FT                   QDSISVSSPRQSGSDYRRSHELASRPSSQQQSSPTQSGEYFATFNGMAPPVPPKTPIPY
FT                   PAQEDDGGVAMPAPLFSQAPSSTSNTKVRPPYPVDEPPPTVNRQRKPSYHVR"
     atggatccag ccaatctgcg ccgcaaggac accaccaagg gtcctccgct gcggatcctg        60
     tctctagatg gcggtggtgt tcgtggctac tctatgctta ttctcctcca ggaactcatg       120
     taccgcactt atgttgaatg cgaaggcaag cctccacgtc gagaccagat tcccaaacct       180
     tgcgatcact tcgacttgat cgccggtacc ggcactggcg gcttgatcgc cctgatgctc       240
     ggtcgcctcc gcctggatct cgagacttgc aaagaagtat acgtacgcat gactcgcaaa       300
     gtattcgaga ccgacaagac catcgctggt attccctacc gctcgacttt gttcaaggcc       360
     tcgaagctcg aggaggcgat ccgggaatgt gtgcgggaac atacagtgta cgagacggag       420
     ggaaatgaca cggggaatgc tcccaatcgt gattccatgg cctctatgac cagtctgcca       480
     tacagtccag cctccatccc acaacgctct attagccgtg gcagtttcag cactgctgct       540
     gcttcgcatc caatgtcccc gaccagccaa agaggctctg tttttctgaa tgggttgcgt       600
     tggggtaacc cagatgcgct gctttatgat aaccgagaaa atcggacgaa aactgcggtc       660
     actgctatgt acaagggcac tccgcgtaaa ggaacggctg tccttctacg atcctacgac       720
     tcccgccggg aacctccacc tgaattcgac tgcactatct ggcaagcagg acgtgcgaca       780
     tctgcgacgg ggcttgcttt caagcccatc cagattggtc agcaccattt tattgatgag       840
     ggtcatggca cattcaatcc cgcgccgctg gtccttgatg aggctgtcgt gaacgagtgg       900
     ccgggtcgag aagttggggt cttcgtgagt gtgggaactg gaaagcgccc acctggcacc       960
     aataaccgac aacatgaatg gtgggaggat ttcttcagcg actcgttggg tacatttgct      1020
     gaagcgcggc gtcggctgat gacgaagatt gagggctgcg aggatattca caatgatatg      1080
     cttcgagatc gtctcgcgaa acgcaatgtc agcaaagaca actatttccg cctcaacgtt      1140
     gaggttgggg ttggcgagtt tggtatgaat gaatggcacc ggctagccga tatcagtacc      1200
     aacacacggc agtatctggc cagacctgaa gtcaagaaga tgattctaga agcaggtgtg      1260
     agatttgcta agatcgaccg catgaaccgc cgtctggcga gccatgccgc agctggcggg      1320
     gatcgcgacg acctatcgtt tgatcttgag actgaagagc tttcgctttc tcctcccgtt      1380
     caatcacatg ttccaccccc tgcgcacttc gctgtcgaac tacctgcgga attacctgcg      1440
     gacttcgttg gctccgcaca ccaccctcca ccttcacaag cgccccttcc cattccaacc      1500
     gtggtgacta catccccaac ggaagacaca ctcccgattc acccaacacc tcaggatagc      1560
     atatctgttt cctcgcctcg gcaatccggc agtgattatc gccgaagcca cgagcttgca      1620
     agccgaccaa gctcgcagca acagagctcg cctacccaga gtggtgagta ctttgcaacc      1680
     ttcaatggca tggcaccacc agtgccgccc aagacgccca tcccataccc agctcaagaa      1740
     gatgacggag gcgtggctat gcctgcacca ctattctccc aagcaccatc gtctacctcg      1800
     aacaccaaag tccgaccccc ttacccagtt gatgagccgc caccaacggt aaaccggcaa      1860
     cgtaagccca gctaccacgt gcggtga                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page