(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE499

PENCW_10.PE499       Location/Qualifiers
FT   CDS_pept        join(complement(1225563..1225577),
FT                   complement(1224316..1225507),complement(1224233..1224255))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672740"
FT                   /orf_name="Pc13g04990"
FT                   /product="Pc13g04990 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP91568.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniParc:UPI0001830F85"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D9"
FT                   /transl_table=1
FT                   /translation="MKVSQLYVYPVKSLRPTTITEGILTTRGFRYDRHFMLLKVIPVED
FT                   GSGTTTLKNMHVPHFPEMALFRTDIEYPETEKDSGKLIITYHPPAESATRPRETNRLEI
FT                   PLQPDPKALNPLKIVMHQSPTTGYNMGAEYNNWFSARFGYPVVLAYLGPHSREVLGTLA
FT                   PAKKDKKTPLRTICESLTSPDRKWERVLPILIVASAINILLHGGTIIRDGITPQTARSL
FT                   SPTIFTASAVVLVLVLYYFYTVHAQHEDRITFADCAPYLVISETSVDNVSARLPDGEEM
FT                   DRTKFRPNIVVSGAGEAFEEDFWGALTVNAGLERGSSRLLLTGNCVRCQSLNVDYETGK
FT                   MGTGESGAVLKKLMKDRRVDSGAKYSPVFGRYAFLEPKGEGISLRVGDEVMVSEKGTKR
FT                   SIFDWPGMTN"
     atgaaagtca gccagctcta tgtttacccg gttaaatccc tccgaccaac aacaatcaca        60
     gagggtatcc taactacacg cggctttcga tatgaccgcc acttcatgct cctcaaagtc       120
     atcccagtcg aggatggctc cggcaccaca accctaaaga acatgcatgt cccgcacttc       180
     ccagagatgg ccctctttcg cacagacatc gagtatccgg agacagaaaa ggacagtggg       240
     aaattgatta tcacatacca ccctccagca gagtcagcta ccagaccccg cgaaaccaat       300
     cgactggaaa tcccactcca gcccgaccca aaagccctca accctctcaa aatcgtaatg       360
     caccagagcc caacaacagg atacaacatg ggcgcagagt acaacaactg gttcagcgct       420
     cgcttcggat accccgtagt cctagcctac cttggcccgc attcgagaga ggtgcttggc       480
     acactcgcgc cagcaaagaa agacaaaaag acaccgctgc gtacaatatg cgaaagccta       540
     acaagccccg acaggaaatg ggaacgtgtc ctcccaattc tcattgtagc atccgcaatc       600
     aacatactcc ttcatggtgg tacaatcatc cgcgacggga taacccccca aacagctcgc       660
     agtctctcac ccaccatttt cacggcgagt gcggtagtgt tggtgctggt gctatattac       720
     ttttacactg tgcacgcaca gcatgaggac cgcattacgt ttgcggactg cgcgccttat       780
     ctggttatct ccgagacatc cgttgataat gtctcagcgc ggctgccgga cggggaagag       840
     atggaccgca cgaagttccg gcctaatatt gttgtttcgg gggctgggga ggcttttgaa       900
     gaggactttt ggggtgcgct gaccgtgaac gctggattgg agcgtgggtc aagtaggctg       960
     ttgctgacgg ggaattgtgt acgctgtcag agccttaatg ttgattatga gactgggaag      1020
     atggggactg gtgagtctgg tgctgtgctt aagaagttga tgaaggatcg cagggtggat      1080
     tctggggcga agtatagccc tgtctttggt agatatgctt tcttggagcc gaagggtgag      1140
     ggaattagcc tgagggttgg ggatgaggtt atggtttctg agaaaggaac taagaggtct      1200
     atttttgact ggcctggcat gacgaattga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page