(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE5

PENCW_10.PE5         Location/Qualifiers
FT   CDS_pept        complement(14290..16698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947666"
FT                   /orf_name="Pc13g00050"
FT                   /product="Pc13g00050 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91074.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR015706"
FT                   /db_xref="UniParc:UPI0001830CF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H2"
FT                   /transl_table=1
FT                   /translation="MEEVERQLLATKSWKAPGEDGLPAIVWKMTWPVVKHGVLELFQAS
FT                   VDEGTLPKQWRHAKIIPLKKPNKENYTIAKAWRPISLLATLGKVLESVIAERISHAVET
FT                   YGLLPTSHFGARKQRSAEQALLLLQEQIYAAWRGRRVLSLISFDVRGAYNGVCKERLLQ
FT                   RMKARGIPEVLLRWVEAFCSERTATIQINGQASEAQSLPQAGLPQGSPLSPILFLFFNA
FT                   DLVQRQIDGQGGAIAFVDDFTAWVTGPTAQSNRHGIETIINEALDWERRSGATFEADKT
FT                   AIIHFAPKASKLDSEPFTIKGETVEPRDHVKVLGVIMDTRLKYKEHMARAASKGLEAAM
FT                   ELRRLRGQSPATARQLFTSTVAPVVDYASSVWMHAFKNKNIGPINRVQRVGAQAIVGTF
FT                   LTVATSVAEAEAHIATVQHRLWRRAAKTWTDIHTLPATNPLRRSTAQIKKFRRYHRSPL
FT                   YQVADALKSIDMETLETISPFTLAPWEERVQGDGQNVPETQTETGGIMRIAVSSSARNG
FT                   MVGFGVAIEKQPPRYRKPRLKTFSVTLGARIEQNPYSGELAAMAYALGTLRVTLLTSNK
FT                   AAALTLKDPRQQSGQEHICQAYKLIKRLRKHENRINNCWVPTSEDNQLLGLAKEQARTA
FT                   TQEDSTPQAQVPRVKSTTLNISRSQAVPKNCLPENVGKHSKRVDAALPGKHTRQLYDRL
FT                   SWKEASVLAQLRTGMARLNGYLYRINVAESDQCACGQARETVEHFLFRCQRWTTHRTEM
FT                   LQCTHTHRGNISFFLGGKSPLDDQNWKPNLEAVRATIRFAIATGRLDAA"
     atggaggagg tcgaacggca gctgctggcg acaaagtctt ggaaagcgcc tggtgaagat        60
     ggcctaccgg cgatagtgtg gaagatgacg tggcccgtgg tcaaacacgg ggtcctggag       120
     ctgttccaag cgtcggtgga tgaaggcaca ttgcccaagc agtggagaca tgcgaagatc       180
     ataccactca aaaagccgaa caaagagaac tatacgattg cgaaggcctg gaggccgatc       240
     tcactcctcg cgacactggg caaggtcctg gaatctgtca tcgcagaaag aatctcacac       300
     gcggtggaaa cctacggcct acttccgacc agccactttg gggctcgtaa gcagcggtcc       360
     gcggagcaag cgctcttact tttgcaagag caaatctacg cggcgtggcg tggccgacgg       420
     gtcttgagcc tgatcagctt cgatgtcaga ggagcctaca atggggtctg taaggagcga       480
     ttgcttcaaa ggatgaaagc gcgagggatc ccggaggtcc tgcttaggtg ggtcgaagcg       540
     ttctgctcgg agcgaacggc gaccatccaa atcaatgggc aagcatctga ggcccaaagc       600
     ctcccacagg ctggactgcc tcagggttct ccactgtctc cgatcctgtt cctcttcttc       660
     aacgcagacc tcgtacagcg acagatcgac ggccagggag gcgcgattgc cttcgtggat       720
     gactttactg cgtgggtgac cggaccgact gcgcagagca accggcacgg tattgaaaca       780
     atcatcaatg aagcactcga ctgggaaaga agaagtggtg cgacttttga agcagataaa       840
     actgccatta tacacttcgc ccccaaggct agcaagttgg actcggagcc attcactatc       900
     aagggagaga ctgttgaacc cagagaccat gtcaaggttc ttggcgtcat catggacacg       960
     agactcaaat acaaggaaca tatggcgagg gcagcgtcca agggactcga ggcggcgatg      1020
     gagcttcggc ggcttcgggg tcaatcccca gcaacagcgc ggcagctatt cacatcgact      1080
     gtagccccgg tggtggacta tgcctccagt gtctggatgc acgcattcaa gaataagaac      1140
     atcgggccga tcaaccgagt gcagagagta ggagcgcaag cgattgtcgg gacattcctc      1200
     acagttgcga ccagcgtagc ggaagcggag gctcacatcg ccacggtgca acaccggctc      1260
     tggagacgag ctgcgaagac gtggacagac atccacaccc taccagcaac caatcccctc      1320
     cgcaggagta ctgctcagat caagaaattc agaagatacc accgctcgcc attatatcag      1380
     gtcgcagacg cgctgaagag cattgatatg gaaacactgg aaaccatcag tccattcaca      1440
     ttagcaccat gggaggaacg tgtacagggc gatggccaga atgtaccaga gacacaaacc      1500
     gaaacgggcg gtataatgcg aatcgcggtc agcagttcgg cgcggaatgg gatggtagga      1560
     tttggcgtgg cgattgagaa gcagccacct cgatatcgaa aaccgaggct gaaaactttc      1620
     tccgtcacgc tgggtgcaag aatcgagcag aacccatact ccggcgaatt ggcagcaatg      1680
     gcatatgcac tgggcacgct acgggtcacg ctgctcacga gcaacaaagc ggcggctctc      1740
     acgctgaagg accctcgaca gcagtcgggc caggaacaca tctgccaagc atacaagctg      1800
     atcaagagac tacggaagca cgagaaccgc atcaacaact gttgggtccc gaccagcgaa      1860
     gataatcaac tgctaggcct agcaaaagag caggctcgga cggcgaccca agaggattct      1920
     accccgcaag cacaggtccc ccgggtgaag tcgacaacac tgaacatctc aagatcccaa      1980
     gcagtcccca aaaattgcct gccagagaat gtagggaaac actccaaacg agtggatgca      2040
     gcactcccag gaaaacatac ccgacaattg tatgatcgat tatcgtggaa agaagcaagc      2100
     gtgctagccc agctccggac tggcatggcg agactcaatg gatacctcta tcgaatcaac      2160
     gtcgcagagt cagatcagtg tgcatgtgga caagcaagag agaccgtgga gcactttctc      2220
     tttcgatgtc agaggtggac cacacaccgg acggaaatgc tgcaatgtac tcatactcac      2280
     cgaggcaaca tatcattttt cctgggcggg aaatcgcctt tggatgacca gaactggaag      2340
     ccgaatttgg aagcagtgcg agccacaata cggtttgcaa tcgccacggg ccgactcgac      2400
     gccgcttaa                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page