(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE500

PENCW_10.PE500       Location/Qualifiers
FT   CDS_pept        join(1226250..1226603,1226675..1226777,1226832..1227184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951956"
FT                   /orf_name="Pc13g05000"
FT                   /product="Pc13g05000 protein"
FT                   /protein_id="CAP91569.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830F86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E0"
FT                   /transl_table=1
FT                   /translation="MDSAELQDGTCHPRWDVLYSAAGFSPPVPETINDRASEKCNMLNP
FT                   GGVTVLRLSPDMVVKYGPHVTITEAQSMIFVAEHTKATPIPKVFAYCTYGPLNRDIDDY
FT                   GSLFDTYIFMSLVGTYMDELREIRSEPYIGSVNKGPVRDQTFDNFHVKGPFESEETFNE
FT                   TILDAYQANFPKRHIRSFLAGMLSQKRHSVCFTHADLRPQNIMVRGGSITGIIDWELSG
FT                   WYPEYWEFAKALYVWRWQNDWVDYLTKALEPYYNEYAVHSFVAEALW"
     atggactccg cggaacttca ggacggtact tgccatcctc gatgggacgt cctttattcc        60
     gctgcaggct tctccccacc tgttccagag actattaacg atcgagccag cgaaaaatgc       120
     aatatgctga acccgggtgg tgtcacagta ctgagactat ctcccgatat ggtcgtgaaa       180
     tatgggccac atgttaccat caccgaagcg cagagcatga tttttgtggc agagcacacg       240
     aaagcgactc ctattccgaa ggttttcgcg tattgtactt atggtccact caacagagac       300
     atcgatgact atgggagcct ttttgacacc tacatattta tgagtcttgt tgggacatat       360
     atggacgagc tccgtgagat cagaagcgag ccctacattg ggtctgtcaa caaaggacct       420
     gtcagggacc agacttttga caacttccac gttaaaggtc cctttgaatc agaggagaca       480
     ttcaacgaaa caatcctcga cgcatatcag gcaaacttcc caaagcgaca catcagaagt       540
     ttccttgcgg gcatgctctc ccagaaaagg cacagtgttt gttttactca tgcggatttg       600
     cgtccgcaaa acatcatggt gcgaggtggg agtatcactg gtattatcga ttgggaattg       660
     agtggttggt atccagaata ctgggagttt gcaaaagcac tctacgtctg gaggtggcag       720
     aacgactggg tcgattactt gacgaaagct ttggaaccgt attataatga atacgctgtc       780
     cattcgttcg tggccgaagc cttatggtga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page