(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE501

PENCW_10.PE501       Location/Qualifiers
FT   CDS_pept        join(complement(1229367..1229519),
FT                   complement(1229252..1229308),complement(1229100..1229193),
FT                   complement(1228903..1229040),complement(1227704..1228848))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672741"
FT                   /orf_name="Pc13g05010"
FT                   /product="Pc13g05010 protein"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /protein_id="CAP91570.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI0001830F87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E1"
FT                   /transl_table=1
FT                   /translation="MYLSRCGRSAARLLPLGSSRAAVVSARASIVPRLAPQSRGVATST
FT                   RDTQHKLLAASLEESDPTVWNILQKEKQRQKHFINLIPSENFTSQAVLDALGSVMQNKY
FT                   SEGYPGARYYGGNEHIDASERLCQQRALETFRLNPEEWGVNVQPLSGSPANLMAYSALL
FT                   NTHDRIMGLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSAT
FT                   LYRPKLIIAGTSAYSRLIDYPRMRAIADSVGAYLLADMAHISGLVAADVLPSPFPYSDV
FT                   VTTTTHKSLRGPRGAMIFYRKGVRSTDKKGNPVMYDLENPINASVFPGHQGGPHNHTIT
FT                   ALSVALKQAQSPDFEAYQKTVLRNASALAGRLGDSTSNGGLGYNIVSGGTDNHLVLVDL
FT                   KNRGVDGARVERVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVA
FT                   DIVDRAVTITQKLDKAARESAQSRGVKNPNTVKAFLDYVGEGEEISEIVVLRQEVEDWV
FT                   GTFSLPWADDQ"
     atgtatttgt ctcgctgtgg taggtctgct gctcgcttgc tcccccttgg gagctcccgg        60
     gcagccgttg tctccgctcg cgcctctatc gtgcccagat tagcccccca atcgcgggga       120
     gtagcgacat ccacccgtga tacgcaacac aagttgctcg cagcctctct ggaggagtcc       180
     gaccccaccg tttggaacat tctgcagaag gagaaacaac gtcaaaagca cttcattaac       240
     ctgatccctt ccgagaattt cacatcgcaa gctgttctcg atgccctagg cagtgttatg       300
     caaaacaaat attctgaggg ataccccggt gcccggtact atggaggaaa cgaacacatt       360
     gatgcctccg agcggttgtg ccagcagcgt gccctagaga ccttccgtct gaacccggag       420
     gaatggggag tgaacgttca acctctgtct ggctcacccg ctaacctcat ggcctactcc       480
     gccctcctca acacccacga ccgcatcatg ggcttggacc ttcctcacgg tggccacctg       540
     tcccacggtt atcagactcc taccaagaag atttccgcta tctccaaata cttcgagacc       600
     ttcccttacc gcctcgacga gtcaactggt ctgattgact acgacgcgtt ggagaagtcg       660
     gccaccctat acaggcctaa gctgattatc gcgggtacct cggcctatag tcgcctgatt       720
     gactacccgc gtatgcgcgc gatcgctgac tccgtgggtg cctacttgct ggccgatatg       780
     gcccatatct cgggtcttgt ggctgccgat gtgctcccat ctcccttccc ctactcagat       840
     gtcgtgacca ccaccaccca taagtctctg cgtggcccgc gtggcgctat gatcttctac       900
     cgtaagggcg tgcgtagcac agacaagaag ggcaaccccg tcatgtacga tctcgagaac       960
     ccaatcaacg catccgtctt ccccggccac cagggtggcc ctcacaacca cactatcact      1020
     gcgctatccg tggccctcaa gcaggctcag tcgcccgact tcgaggccta ccagaagaca      1080
     gtactccgca acgcatctgc tctggccggc cgtctaggtg actccaccag caacggtgga      1140
     ctcggctaca acattgtgtc cggtggcacc gacaaccacc tggtgctagt ggaccttaaa      1200
     aaccgcggtg tggacggtgc tcgtgttgag cgcgttctcg agctgtgtgg tgtcgccagc      1260
     aacaagaaca ccgttcccgg tgacaagtct gccctcaagc ccggcggtct gcgtctagga      1320
     accccagcca tgacttcccg tggcttccag cccgaggact tcacccgcgt cgccgatatc      1380
     gtcgaccgtg cggtcaccat cacccagaag ctggacaagg ctgcccgcga gtcggctcag      1440
     tcccgcggtg tcaagaaccc caatactgtc aaggcgttct tggactacgt gggtgagggt      1500
     gaggagatct cggagattgt tgtgctccgc caagaagtcg aggactgggt tggtaccttc      1560
     agcttgccgt gggctgatga ccagtag                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page