(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE503

PENCW_10.PE503       Location/Qualifiers
FT   CDS_pept        join(1233194..1233337,1233388..1233470,1233528..1233771)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129810"
FT                   /orf_name="Pc13g05030"
FT                   /product="Pc13g05030 protein"
FT                   /protein_id="CAP91572.1"
FT                   /db_xref="UniParc:UPI0001830F89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E3"
FT                   /transl_table=1
FT                   /translation="MRFSIAALTLGAAGAMAGVVTETVTEYTTYCPEATSVVHGSKTYS
FT                   ISTPGYITMSHGPYTVTRPLVTSTVTECNSCSSTPAVSTPVASSSVPLIPVVPSVATST
FT                   PLVPSAGSTGVPSAPSSAATPSQPAFNAGAINAATGAGAGLAAVFGAVALLL"
     atgcgtttct ctattgccgc tctcaccctc ggtgccgctg gtgccatggc cggtgttgtc        60
     accgagactg tcaccgagta caccacctac tgccctgagg ccacctccgt tgtgcacgga       120
     agcaagacct acagcatctc cacccccggc tacatcacca tgagccacgg tccctacacc       180
     gtcactcgtc cccttgtgac ctccaccgtg actgagtgca actcctgctc ttccaccccc       240
     gctgtctcca cccccgtggc tagcagcagc gttcccctca tccccgtcgt ccccagcgtc       300
     gccacctcca cccctctggt ccccagcgcc ggctccactg gcgtgcccag tgctccctcc       360
     agcgctgcca ccccctccca gcccgccttc aatgccggtg ccatcaacgc cgctaccggt       420
     gctggtgccg gtctggctgc cgtcttcggt gccgttgccc tcctgctgta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page