(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE504

PENCW_10.PE504       Location/Qualifiers
FT   CDS_pept        join(1234400..1234468,1234592..1235413)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978597"
FT                   /orf_name="Pc13g05040"
FT                   /product="Putative uncharacterized protein Pc13g05040 "
FT                   /protein_id="CAP91573.1"
FT                   /db_xref="UniParc:UPI0001830F8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E4"
FT                   /transl_table=1
FT                   /translation="MSAIPKENVQASTRLKDPTHAQQEFFDADSPESIATPATKKRKRD
FT                   GSRAKRLRMSSSMETISPGSIHSKTSETSHKRSPKESKRDNSATKSAMSREMQQCTSSE
FT                   PARLELPPKPASEQKAVNDNVFTNTNPFGLADLPPSEFVFPRDVDFDYPCDERETSYEP
FT                   VSECLPEHPQVPTPYTPVLRAGSQYNQRIWNQYGGKCETWLARQLYDELHDITTRIGDI
FT                   MCGIRLMLDMRGPSDGFEGLGEHHFEAEESHGALKGDGPEDPLELSDNDDKALFVSGTD
FT                   EPSSSDEFSGFSGDE"
     atgtcggcta ttccaaagga aaatgttcag gcttcaaccc gcctcaaaga tcccacccat        60
     gctcaacagg agttcttcga tgctgactct cctgagtcga ttgcgacccc tgcgactaaa       120
     aagcgcaaga gggatggatc tagggccaag cgtctgagga tgagttcctc aatggagacc       180
     atatccccag ggtcgatcca ctccaagacc tccgagactt cccacaagcg ctcgcccaag       240
     gaatccaaga gagacaacag tgcaaccaag tctgccatgt cgcgtgagat gcagcagtgt       300
     acatcttccg agcccgctcg gctcgaactc ccgcccaagc cggcgtcgga gcagaaggcc       360
     gtgaatgaca atgtctttac caacacgaac ccatttgggc tcgcagacct tccgccttca       420
     gagttcgtct tcccccgcga cgtggatttc gactacccgt gcgacgagag ggagacctca       480
     tacgagccag tctccgaatg tctgcccgaa catccccaag ttcccactcc gtacaccccg       540
     gtcttgcgcg cgggctcgca gtacaaccag cgcatctgga accagtatgg gggcaaatgt       600
     gagacttggc tggcgcgtca gttgtacgat gagctgcatg acatcactac ccgcattgga       660
     gacatcatgt gtgggatcag gttgatgctg gatatgaggg ggccgagtga tggttttgag       720
     ggtcttggtg aacatcattt tgaagctgaa gagtcccatg gtgcactcaa gggtgatggt       780
     cctgaggatc cgttggaact gagcgacaat gatgataaag cactctttgt gagcggcact       840
     gatgaaccct ccagctctga tgagttcagc ggcttctctg gggatgaata g                891
//

If you have problems or comments...

PBIL Back to PBIL home page