(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE505

PENCW_10.PE505       Location/Qualifiers
FT   CDS_pept        complement(1235621..1236676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825431"
FT                   /orf_name="Pc13g05050"
FT                   /product="Pc13g05050 protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91574.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0001830F8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E5"
FT                   /transl_table=1
FT                   /translation="MSTQTTTTRNPADSMVSTWRHDRSQWNTYHWMIELLGLHLIDFDA
FT                   EVPIFSKKDKIPAIREWTVHLWILLHAAIPLAIHHAYTIYTGQNMHLIGAFALYSSAFK
FT                   LNGIHEMHIMRRLGQVYGFLDGDKHPRDEIPDVGVGKVIRELISTSTLRMVMAIFLTYR
FT                   PGETPTSLEWKWLPLEIGLYSITVDFWFYWYHRMMHSVGPLWKFHRRHHLTKHPNPLLS
FT                   AYADHEQEFMDITGIPLLAYTTLKIIGLPMGFYGWWICFQYIAFSEFIGHSGLRLHGGA
FT                   PSTVNWLLEIFDAELVIEDHDLHHRYGWRKSHNYGKQTRLWDSIFGTCHERIESVKENV
FT                   DYTNRVTMPLL"
     atgtccaccc agacgaccac cacgcgcaat ccggcagact ccatggtgtc tacctggcgc        60
     catgaccgat cccaatggaa cacctaccac tggatgattg aactccttgg cttacatctc       120
     attgattttg acgcggaggt tccaatcttc tccaagaaag ataaaatacc cgccataaga       180
     gagtggacgg tccacttatg gattctacta cacgccgcaa tcccacttgc aatacaccac       240
     gcctacacaa tctacactgg gcagaacatg catctcatcg gcgcttttgc attgtactct       300
     agtgcattca agctgaacgg cattcacgag atgcacatca tgcgccgcct aggccaagtc       360
     tatggcttct tggatggcga caagcatcct cgggatgaga tccctgatgt tggcgtgggc       420
     aaggtgatac gggagctgat atccacctca acgctgcgta tggtgatggc aatatttctt       480
     acctaccggc cgggggagac accgacatca ctggaatgga agtggcttcc cttggagatt       540
     ggcttgtaca gtatcacggt ggacttctgg ttttactggt atcaccgcat gatgcactcg       600
     gtgggccctt tgtggaagtt ccaccgtaga caccatctga cgaaacatcc caatcctttg       660
     ctctctgcgt acgccgacca cgagcaggaa ttcatggata ttacgggtat tccgcttctt       720
     gcatacacta cgttgaagat cattgggttg cccatggggt tttatggatg gtggatttgt       780
     tttcagtata ttgccttctc ggagttcatt ggtcatagtg ggctacgact tcatggtggt       840
     gcaccctcta ctgtgaattg gctgctggaa atttttgatg ctgagttggt gattgaagat       900
     catgatctac atcaccgcta tggatggagg aagagccata actatggcaa gcagacacgt       960
     ctttgggata gcatttttgg aacctgccat gagcgcatcg aaagcgtgaa agagaatgtt      1020
     gattacacaa atcgggtgac aatgcctctt ctttga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page