(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE506

PENCW_10.PE506       Location/Qualifiers
FT   CDS_pept        join(1238132..1238536,1238594..1239529)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672742"
FT                   /orf_name="Pc13g05060"
FT                   /product="Pc13g05060 protein"
FT                   /protein_id="CAP91575.1"
FT                   /db_xref="UniParc:UPI0001830F8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E6"
FT                   /transl_table=1
FT                   /translation="MESTKVPKRPTLRWNKCRRQVLCCLFRFFVCSKKQTEEIFSYMFR
FT                   SHLNDRGIQGFVPFATLNTQWVWMKTRRDPVWSHVHTSTVFDTDEEWKEIIARIKSAAK
FT                   TLRFELLEKTADTNISRSSSAGADDERSITLNGPAAPMLPHSFSTPETLSPMVLVSPRG
FT                   DYGFGENSRANQSIEQNVDLTIDRTIDQRNDSQNDLYNELNRPNEPVVTGHGKLCFWCK
FT                   HEGAIYDPEEELQNEVYNDSGYEDDSRGNEHDNPQDDPVMREYARGLKQFTRELHGEVP
FT                   YSDEESPDSGSEAYLMTPHEGLSNVRHFCDPHISSLSNLEQEPLDSEDNSDWCADRESP
FT                   VDLTGFGTPSISEDQNGSLVDERISAREALSRFRFPHTRAGRDETPDDGLSRRASRYEW
FT                   PPNDEIMVETLRQLSVEALRQVENQSNNRTHQEMDVLMYDGNTWNQV"
     atggagtcaa ccaaggtccc caagagaccc acgctacgat ggaacaaatg caggcgacag        60
     gtgctttgct gtttgtttcg cttctttgtt tgcagcaaaa agcaaaccga agagatattc       120
     tcgtacatgt ttcggagtca tctaaatgat cgcggcattc aaggctttgt tccatttgcc       180
     acactgaaca cccagtgggt ttggatgaag accagacggg atccagtttg gtcccacgtg       240
     catacgagca ccgtatttga caccgacgag gagtggaaag agatcattgc aagaatcaaa       300
     tccgcagcca aaactttgcg gttcgaactc cttgagaaga cggcggacac caacatatcg       360
     cgctcgagct ctgcgggggc cgatgacgaa cggagtatta cactcaatgg acccgccgcg       420
     ccgatgcttc cgcattcgtt ctctactcca gagactctca gcccgatggt attggtatcc       480
     ccgagggggg attatggctt cggtgaaaat tccagagcaa accaaagcat cgagcaaaac       540
     gtcgacctga ccatcgaccg gacgattgac cagaggaatg attcccagaa tgacctctac       600
     aatgaactca ataggcccaa cgagccggtc gtcactggcc atggaaagct ctgtttctgg       660
     tgcaaacacg aaggagccat ctacgatccc gaggaagaac tacaaaacga agtctacaat       720
     gacagtggat acgaggatga tagtcgtggc aacgaacatg ataatccaca agacgatcct       780
     gttatgagag agtatgcccg aggactcaag cagttcacga gggagctaca tggtgaagtt       840
     ccttattcgg atgaagaatc gcctgattca gggagcgagg cgtacctgat gacaccccat       900
     gaagggctct caaacgtgcg ccatttttgc gacccacaca tatcttcgct ttcaaaccta       960
     gaacaagagc ctctggactc tgaggataat tcagattggt gtgctgacag agaaagccct      1020
     gttgatttga ctggttttgg gactccttcg atctcggaag accagaatgg ttcccttgtc      1080
     gatgaacgaa tttccgcacg agaggctctg tccagattcc gttttcccca tacccgcgcg      1140
     ggtcgcgatg agacacctga cgacggcttg agtcggaggg cgtcgcggta tgaatggccc      1200
     ccaaatgatg aaataatggt ggaaactcta cgccagttgt ccgtggaagc tcttcgccag      1260
     gttgaaaacc aatcaaacaa tcgcactcat caggagatgg atgtcttgat gtatgacggc      1320
     aatacctgga accaggtgta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page