(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE51

PENCW_10.PE51        Location/Qualifiers
FT   CDS_pept        join(complement(117225..117313),complement(117129..117162),
FT                   complement(116626..116985))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977824"
FT                   /orf_name="Pc13g00510"
FT                   /product="Putative uncharacterized protein Pc13g00510 "
FT                   /protein_id="CAP91120.1"
FT                   /db_xref="UniParc:UPI0001830E99"
FT                   /db_xref="UniProtKB/TrEMBL:B6H189"
FT                   /transl_table=1
FT                   /translation="MQTSGSRTVSNLDRLTVYGPKELKRTVHDPAIYTSPTSVAREYLR
FT                   LLARLDSRAVRAERAQSKLEQELSASRAAENQATEELGHVSRLADIFFELSQILGGVVD
FT                   HWLKERGTKEPGQEPESTKVMLDVLLKQLEAQEFANSGEKSGDDSESGTEAAAQRS"
     atgcagacct cgggttctcg caccgtttca aacttggacc ggttaaccgt atatggtcca        60
     aaagagctca aacggaccgt tcacgaccca gctatatata caagcccaac ctccgttgct       120
     cgagaatatc ttcgactcct cgcgaggctc gacagtcggg cagtccgggc agaacgagcc       180
     cagtccaaac ttgaacaaga attgagcgcc tccagggctg ccgagaatca agcgacagag       240
     gagctgggcc atgtgtccag attagcggat atcttctttg aactcagtca aatcctgggg       300
     ggcgtggtag atcattggct gaaggagcgc ggaaccaaag aacccggcca agagccggag       360
     tcaacaaagg taatgcttga tgtgttgttg aaacagttgg aagcacagga gtttgccaat       420
     agcggtgaga aatccggtga tgactcggaa agcggcacag aagctgcggc ccagcgcagc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page