(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE53

PENCW_10.PE53        Location/Qualifiers
FT   CDS_pept        join(124917..126780,126842..127294,127657..127882,
FT                   127928..128045)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948701"
FT                   /orf_name="Pc13g00530"
FT                   /product="Pc13g00530 protein"
FT                   /protein_id="CAP91122.1"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI0001830E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H191"
FT                   /transl_table=1
FT                   /translation="MPGGHPTTTAIQNDLAEILLGLFIPWQNLQSLFHQTRTGSATTVD
FT                   LHHIWMSIEPTLSSYVRTFAQNIELLRKSKTDCQADAILRDRSAQNTSSVDQDLTSPPY
FT                   PISDSENESIRFSQHVDDSISKETLLAAFFAIGRGWSNEANDAQRRIPTLTSTSLPSSP
FT                   LQFDNFGPIPISNSTLYESTGLQFFPLFTLQEWKTRLQNITKAVNQDTQPGMPTTTASD
FT                   LDDFNLGMADDVLVPILTEPDLSLDLQHRRSEIGQNPTGASLTSLVRDIIPLNEKQRLV
FT                   VERVISNLLACVNHPYDSSMRQQTLLYVGGEGGVGKSQIIKAIVAVMDLIHRKDEVILM
FT                   APTGAAADVIGGSTYHTSLGISLNRYRRGGVAPRVRSLWSRKTVMIIDEVSMIDLSALS
FT                   IINTHCKIARSLDRSSPHLFGGLPVVILMGDFHQFPPVQGQALWKLPRNDTEQDGKLIW
FT                   NQFQQVIILHEQMRQAEDIPYQNLLGRARSGTLTSDDLSTLNSKAITSLTDPHLQPATV
FT                   IVKLNSLRHVINRLQIERFARARHQNIFVFPALHTRTRSSGPTSLQLRADDLLGLPEQG
FT                   AKVPFPGLILYTLSMPTMVLTNICTPAGLVNGATGQAMGIAIDPQAEFLKLDDLYIFCT
FT                   KPPVCLLFKPARTQSNLFQSLDSGILPIFPLEMSITVKGYSVRRKQIPICPAFCLTDYK
FT                   IQGATLDSVILDLKDDTKSRRQESHRKYCSTYVQLSRLRSLHGLHLLQSISMSDLEHRP
FT                   DPQLLEEMRRLQTLQEQTLGLSLQLRVSLNIPSQDIHSDDVEQNEIPTLIRFFNEGNRP
FT                   DLYQPNAFVYSSGSFPTTSSEDEGFHIVLHAHNLDRHPGNQEDTASYFMHCPGAAQPIV
FT                   TFLGVAASFLSGVVT"
     atgccaggtg gacaccctac aaccactgca attcagaatg atctagccga gattctcctg        60
     ggactcttca ttccttggca gaacttgcaa tcacttttcc atcaaacacg tactggctct       120
     gccacaacag tcgaccttca tcacatctgg atgtctatcg agccaacact ttcatcatat       180
     gttcgcactt ttgcgcagaa catcgaactt ttacggaaat caaagaccga ttgccaggca       240
     gatgctatcc tgcgggatcg ctcggcgcag aatacatcgt cagttgacca agacttaacc       300
     agtccgccct atcctatatc cgattctgaa aacgaatcca tacgtttttc gcaacacgtg       360
     gacgactcta taagcaaaga aacacttttg gcggcttttt tcgcaatagg tcggggctgg       420
     tcgaacgaag caaatgatgc ccagcgacgt attcccactc tcacctcgac aagtttgccc       480
     tcttcgcccc ttcaatttga taactttgga ccaattccga tttcaaacag cacactttac       540
     gagtccactg ggctccaatt cttccctctg tttaccctgc aagaatggaa aacccgtctt       600
     cagaatatta ccaaagccgt aaaccaagac acacaacctg gaatgcccac cactactgct       660
     tcagatcttg acgatttcaa tcttggaatg gctgacgacg ttttggttcc cattttgacc       720
     gaaccagacc tatcacttga cttgcaacac cgtcgttccg aaatcggtca gaatcccacg       780
     ggtgcctcat taacgtcgct ggtgcgcgat attattccac tgaatgagaa acaacgtctt       840
     gtcgtggaaa gagtcatctc taacctcctg gcttgtgtca accacccgta tgactcttcc       900
     atgcggcagc aaactctcct ctacgtggga ggtgaaggcg gagtgggcaa gagccagatc       960
     attaaagcga ttgtcgccgt gatggacctg atccaccgca aggacgaggt tatcctaatg      1020
     gcacctacag gagctgctgc cgatgtcatc ggaggaagca cgtaccatac gtcccttggg      1080
     atttctctca accgctacag acggggtgga gttgctccta gagttcgcag cctatggtct      1140
     cggaagaccg tcatgatcat agacgaggtg agtatgatag acctctccgc attgagtatt      1200
     atcaacacac actgcaagat cgctcggtct ctggatagat cgtctccgca tctttttggg      1260
     gggttacctg tagtgatcct catgggcgac tttcatcaat ttcctccagt ccaaggacag      1320
     gccttatgga aacttccgcg aaatgataca gaacaagacg gaaaacttat ctggaatcaa      1380
     ttccaacaag tcatcatcct tcatgaacaa atgcgccagg cagaggacat accatatcag      1440
     aatttactcg gtcgggctcg atccggcaca ctgacatccg atgacttgtc aactttaaat      1500
     tcaaaggcga tcacttctct cactgaccca catttacaac ctgcaacggt cattgtcaag      1560
     ttgaactctc ttcggcacgt cattaatcgt ctccagatcg agcgcttcgc ccgtgccaga      1620
     catcagaaca tttttgtttt tccggctctc cacacccgaa caagatcttc cggcccaact      1680
     tcccttcagc ttcgtgctga cgacctactg ggtctacccg agcaaggcgc aaaagtcccc      1740
     ttcccaggac tcatcctgta cacgctttct atgccgacaa tggtgttaac aaacatttgc      1800
     acaccggcag gcttggtcaa tggtgcaact ggccaagcca tgggcattgc gattgaccca      1860
     caagcggaat ttttgaaact cgacgacttg tacatctttt gtaccaagcc tccagtctgt      1920
     cttcttttca aaccagcccg cactcaatcg aatctcttcc aatcgcttga tagtggtatt      1980
     ttacctatct ttccactcga gatgtctatt actgtgaaag gatattcagt ccgacggaaa      2040
     caaatcccta tctgtccggc attttgtctc actgactata aaatccaagg cgcaaccctc      2100
     gactctgtca ttctggatct gaaagacgat accaaaagtc ggcggcaaga atcccatcga      2160
     aaatactgct ccacatacgt gcagctgtca cgcctacgtt cgctgcatgg ccttcatctt      2220
     ctgcaatcga ttagtatgag cgaccttgag cacagacctg accctcaatt acttgaagaa      2280
     atgcgaagat tgcaaacgct tcaagagcag actcttgggc tttccttaca actacgtgtt      2340
     tcactcaata taccaagcca ggatattcat tcagacgatg ttgaacagaa tgaaatcccc      2400
     acccttatca ggttctttaa tgagggcaac cggcctgatc tttatcaacc aaatgctttt      2460
     gtctattcgt caggttcttt tcctacaacc tcgtctgagg atgaagggtt tcatattgtt      2520
     cttcacgctc acaatttgga tcgtcaccct ggtaatcagg aagatacagc ctcatacttt      2580
     atgcactgtc ccggagctgc tcagccaata gttactttcc tcggcgtcgc ggcgtcgttc      2640
     ttgagcgggg tggtcactta a                                                2661
//

If you have problems or comments...

PBIL Back to PBIL home page