(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE54

PENCW_10.PE54        Location/Qualifiers
FT   CDS_pept        join(complement(128600..128878),complement(128133..128534))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977825"
FT                   /orf_name="Pc13g00540"
FT                   /product="Pc13g00540 protein"
FT                   /protein_id="CAP91123.1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="UniParc:UPI0001830E9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H192"
FT                   /transl_table=1
FT                   /translation="MDMAELDLQLTNKRLRVLVLYGSLRRRSYSRLVALEACRILFRLG
FT                   CDVRIFDPEGLPVKNDSDTDHPKVQELRELSVWSDGHVWVSPEQHGNLTAVFKNQIDWI
FT                   PLTTGSVRPTQGRTLAIAQVCGGSQSFNAVNSLRILGRWMRMFTIPNQSSIPRAYTQFP
FT                   DEGQPEDQRLMPSGNRDRLVDCMEEFIKYTILMRPHIGLFGDRFSEREEKKAKEEKMNA
FT                   AAAR"
     atggacatgg ctgaacttga cctgcagctt acaaacaaga ggctgagggt tctggtactt        60
     tatggcagtc ttcggagaag gtcatattcg cggctagtgg cactggaagc ttgccgtatc       120
     cttttccggc tcggctgtga tgtgcgtatc tttgatcctg aaggtcttcc ggtgaagaac       180
     gatagcgata ccgatcatcc gaaagtacag gagctccgag agcttagtgt gtggagtgat       240
     gggcatgtct gggtctcgcc tgagcaacac ggaaacttaa ccgctgtatt caagaaccag       300
     atcgactgga ttcctttgac gacaggaagt gtccgtccta cccaaggccg aacgctggcc       360
     attgcccaag tgtgcggtgg atcccaatcg tttaatgccg ttaactcttt gcgtatcctg       420
     ggtcggtgga tgcgcatgtt taccattcca aatcagtcct cgatccccag ggcatatacg       480
     caatttccgg atgaaggtca accagaagat caacgactca tgcctagtgg caaccgagat       540
     cgtctcgtgg attgcatgga ggaattcatc aaatacacga ttctgatgcg gcctcatatc       600
     ggtcttttcg gtgatcgctt tagcgaacgg gaggagaaga aagcaaagga ggaaaagatg       660
     aatgctgctg cagccagata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page